• Gene id: 51076

Gene Summary

• Gene Symbol: CUTC   Gene   UCSC   Ensembl
• Aliases: CGI-32
• Gene name: cutC copper transporter
• Alternate names: copper homeostasis protein cutC homolog, cutC copper transporter homolog,
• Gene location: 10q24.2 (62423875: 62453384)     Exons: 9     NC_000017.11
• Gene summary(Entrez): Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper (Gupta et al., 1995 [PubMed 7635807]; Li et al., 2005 [PubMed 16182249]).[supplied by OMIM, Mar
• OMIM: 610101

Protein Summary

• Protein general information: Q9NTM9  
  • Name: Copper homeostasis protein cutC homolog
  • Length: 273  
  • Mass: 29341
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MKRQGASSERKRARIPSGKAGAANGFLMEVCVDSVESAVNAERGGADRIELCSGLSEGGTTPSMGVLQVVKQSVQ
  IPVFVMIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVFGALTEDGHIDKELCMSLMAICRPLPVTFHRAFDM
  VHDPMAALETLLTLGFERVLTSGCDSSALEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSA
  RSTRDSGMKFRNSSVAMGASLSCSEYSLKVTDVTKVRTLNAIAKNILV

• Structural information:
  • Interpro: IPR005627  IPR023648  IPR036822  
  • PDB: 3IWP
  • PDBsum: 3IWP
  • STRING: ENSP00000359507
• Other Databases: GeneCards:  CUTC  Malacards:  CUTC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005507	copper ion binding	IBA	molecular function
GO:0055070	copper ion homeostasis	IBA	biological process
GO:0005507	copper ion binding	IDA	molecular function
GO:0051262	protein tetramerization	IPI	biological process
GO:0005507	copper ion binding	IEA	molecular function
GO:0055070	copper ion homeostasis	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0055070	copper ion homeostasis	NAS	biological process
GO:0005507	copper ion binding	NAS	molecular function
GO:0006825	copper ion transport	NAS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)