• Gene id: 51074

Gene Summary

• Gene Symbol: APIP   Gene   UCSC   Ensembl
• Aliases: APIP2, CGI-29, CGI29, MMRP19, hAPIP
• Gene name: APAF1 interacting protein
• Alternate names: methylthioribulose-1-phosphate dehydratase, MTRu-1-P dehydratase, probable methylthioribulose-1-phosphate dehydratase,
• Gene location: 11p13 (34916410: 34882294)     Exons: 9     NC_000011.10
• Gene summary(Entrez): APIP is an APAF1 (MIM 602233)-interacting protein that acts as a negative regulator of ischemic/hypoxic injury (Cho et al., 2004 [PubMed 15262985]).[supplied by OMIM, Dec 2008]
• OMIM: 612491

Protein Summary

• Protein general information: Q96GX9  
  • Name: Methylthioribulose 1 phosphate dehydratase (MTRu 1 P dehydratase) (EC 4.2.1.109) (APAF1 interacting protein) (hAPIP)
  • Length: 242  
  • Mass: 27125
  • Tissue specificity: Isoform 1 is ubiquitously expressed. Isoform 2 is expressed at lower levels and detected in heart, brain, pancreas, liver, placenta, skeletal muscle and kidney. {ECO
• Sequence:

  MSGCDAREGDCCSRRCGAQDKEHPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAPSGVQKERIQPEDMFV
  CDINEKDISGPSPSKKLKKSQCTPLFMNAYTMRGAGAVIHTHSKAAVMATLLFPGREFKITHQEMIKGIKKCTSG
  GYYRYDDMLVVPIIENTPEEKDLKDRMAHAMNEYPDSCAVLVRRHGVYVWGETWEKAKTMCECYDYLFDIAVSMK
  KVGLDPSQLPVGENGIV

• Structural information:
  • Interpro: IPR001303  IPR036409  IPR017714  IPR027514  
  • PDB: 4M6R
  • PDBsum: 4M6R
  • STRING: ENSP00000379133
• Other Databases: GeneCards:  APIP  Malacards:  APIP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0019509	L-methionine salvage from methylthioadenosine	IBA	biological process
GO:0046570	methylthioribulose 1-phosphate dehydratase activity	IBA	molecular function
GO:0051289	protein homotetramerization	IDA	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0046570	methylthioribulose 1-phosphate dehydratase activity	IDA	molecular function
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0070372	regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0070269	pyroptosis	IMP	biological process
GO:0019509	L-methionine salvage from methylthioadenosine	IMP	biological process
GO:0019509	L-methionine salvage from methylthioadenosine	IMP	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0019509	L-methionine salvage from methylthioadenosine	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0008652	cellular amino acid biosynthetic process	IEA	biological process
GO:0016829	lyase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0009086	methionine biosynthetic process	IEA	biological process
GO:0046570	methylthioribulose 1-phosphate dehydratase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070372	regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0019284	L-methionine salvage from S-adenosylmethionine	IEA	biological process
GO:0046570	methylthioribulose 1-phosphate dehydratase activity	IEA	molecular function
GO:0019509	L-methionine salvage from methylthioadenosine	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00270	Cysteine and methionine metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)