• Gene id: 51072

Gene Summary

• Gene Symbol: MEMO1   Gene   UCSC   Ensembl
• Aliases: C2orf4, CGI-27, MEMO, NS5ATP7
• Gene name: mediator of cell motility 1
• Alternate names: protein MEMO1, C21orf19-like protein, HCV NS5A-transactivated protein 7, hepatitis C virus NS5A-transactivated protein 7, mediator of ErbB2-driven cell motility 1,
• Gene location: 2p22.3 (32011062: 31861302)     Exons: 17     NC_000002.12
• OMIM: 608524

Protein Summary

• Protein general information: Q9Y316  
  • Name: Protein MEMO1 (C21orf19 like protein) (Hepatitis C virus NS5A transactivated protein 7) (HCV NS5A transactivated protein 7) (Mediator of ErbB2 driven cell motility 1) (Mediator of cell motility 1) (Memo 1)
  • Length: 297  
  • Mass: 33733
• Sequence:

  MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRIF
  ILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAKAMESHKDE
  FTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIE
  QLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCRNWQDSSVSYAAGALTVH

• Structural information:
  • Interpro: IPR002737  
  • CDD: cd07361
  • PDB: 3BCZ 3BD0
  • PDBsum: 3BCZ 3BD0
  • STRING: ENSP00000295065
• Other Databases: GeneCards:  MEMO1  Malacards:  MEMO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032886	regulation of microtubule-based process	IMP	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:2000145	regulation of cell motility	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray