• Gene id: 51065

Gene Summary

• Gene Symbol: RPS27L   Gene   UCSC   Ensembl
• Gene name: ribosomal protein S27 like
• Alternate names: 40S ribosomal protein S27-like, small ribosomal subunit protein eS27-like,
• Gene location: 15q22.2 (63157476: 63148248)     Exons: 4     NC_000015.10
• Gene summary(Entrez): This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit. [provided by RefSeq, Jul 2008]
• OMIM: 612055

Protein Summary

• Protein general information: Q71UM5  
  • Name: 40S ribosomal protein S27 like (Small ribosomal subunit protein eS27 like)
  • Length: 84  
  • Mass: 9477
• Sequence:

  MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTE
  GCSFRRKQH

• Structural information:
  • Interpro: IPR000592  IPR011332  
  • Prosite: PS01168
  • STRING: ENSP00000331019
• Other Databases: GeneCards:  RPS27L  Malacards:  RPS27L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022627	cytosolic small ribosomal subunit	IBA	cellular component
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0000028	ribosomal small subunit assembly	IBA	biological process
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008494	translation activator activity	IDA	molecular function
GO:0006978	DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process	IDA	molecular function
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IDA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0045727	positive regulation of translation	IDA	biological process
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IDA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0031571	mitotic G1 DNA damage checkpoint	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray