• Gene id: 51063

Gene Summary

• Gene Symbol: CALHM2   Gene   UCSC   Ensembl
• Aliases: FAM26B
• Gene name: calcium homeostasis modulator family member 2
• Alternate names: calcium homeostasis modulator protein 2, calcium homeostasis modulator 2, family with sequence similarity 26, member B,
• Gene location: 10q24.33 (103452402: 103446782)     Exons: 4     NC_000010.11
• OMIM: 617154

Protein Summary

• Protein general information: Q9HA72  
  • Name: Calcium homeostasis modulator protein 2 (Protein FAM26B)
  • Length: 323  
  • Mass: 36175
• Sequence:

  MAALIAENFRFLSLFFKSKDVMIFNGLVALGTVGSQELFSVVAFHCPCSPARNYLYGLAAIGVPALVLFIIGIIL
  NNHTWNLVAECQHRRTKNCSAAPTFLLLSSILGRAAVAPVTWSVISLLRGEAYVCALSEFVDPSSLTAREEHFPS
  AHATEILARFPCKENPDNLSDFREEVSRRLRYESQLFGWLLIGVVAILVFLTKCLKHYCSPLSYRQEAYWAQYRA
  NEDQLFQRTAEVHSRVLAANNVRRFFGFVALNKDDEELIANFPVEGTQPRPQWNAITGVYLYRENQGLPLYSRLH
  KWAQGLAGNGAAPDNVEMALLPS

• Structural information:
  • Interpro: IPR029569  IPR029570  
  • PDB: 6UIV 6UIW 6UIX
  • PDBsum: 6UIV 6UIW 6UIX
  • STRING: ENSP00000260743
• Other Databases: GeneCards:  CALHM2  Malacards:  CALHM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005261	cation channel activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0098655	cation transmembrane transport	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R