• Gene id: 51052

Gene Summary

• Gene Symbol: PRLH   Gene   UCSC   Ensembl
• Aliases: PRH, PRRP
• Gene name: prolactin releasing hormone
• Alternate names: prolactin-releasing peptide, preproprolactin-releasing peptide,
• Gene location: 2q37.3 (237566573: 237567174)     Exons: 2     NC_000002.12
• OMIM: 612235

Protein Summary

• Protein general information: P81277  
  • Name: Prolactin releasing peptide (PrRP) (Prolactin releasing hormone) [Cleaved into: Prolactin releasing peptide PrRP31; Prolactin releasing peptide PrRP20]
  • Length: 87  
  • Mass: 9639
  • Tissue specificity: Medulla oblongata and hypothalamus. {ECO
• Sequence:

  MKVLRAWLLCLLMLGLALRGAASRTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATLGDVPKPGLRPRLTCF
  PLEGGAMSSQDG

• Structural information:
  • Interpro: IPR026194  
  • STRING: ENSP00000165524
• Other Databases: GeneCards:  PRLH  Malacards:  PRLH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005179	hormone activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0009749	response to glucose	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0040014	regulation of multicellular organism growth	IEA	biological process
GO:0002023	reduction of food intake in response to dietary excess	IEA	biological process
GO:0005184	neuropeptide hormone activity	IEA	molecular function
GO:0031861	prolactin-releasing peptide receptor binding	IEA	molecular function
GO:0042755	eating behavior	IEA	biological process
GO:0045444	fat cell differentiation	IEA	biological process
GO:0001894	tissue homeostasis	IEA	biological process
GO:0002021	response to dietary excess	IEA	biological process
GO:0006112	energy reserve metabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007631	feeding behavior	IEA	biological process
GO:0043434	response to peptide hormone	IEA	biological process
GO:0048483	autonomic nervous system development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0031861	prolactin-releasing peptide receptor binding	IBA	molecular function
GO:0005184	neuropeptide hormone activity	IBA	molecular function
GO:0043434	response to peptide hormone	IBA	biological process
GO:0007631	feeding behavior	IBA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005179	hormone activity	IEA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq