• Gene id: 51043

Gene Summary

• Gene Symbol: ZBTB7B   Gene   UCSC   Ensembl
• Aliases: CKROX, THPOK, ZBTB15, ZFP-67, ZFP67, ZNF857B, c-KROX, hcKROX
• Gene name: zinc finger and BTB domain containing 7B
• Alternate names: zinc finger and BTB domain-containing protein 7B, T-helper-inducing POZ/Krueppel-like factor, krueppel-related zinc finger protein cKrox, zinc finger and BTB domain containing 15, zinc finger protein 67 homolog, zinc finger protein 857B, zinc finger protein Th-,
• Gene location: 1q21.3 (155002627: 155018522)     Exons: 8     NC_000001.11
• Gene summary(Entrez): This gene encodes a zinc finger-containing transcription factor that acts as a key regulator of lineage commitment of immature T-cell precursors. It is necessary and sufficient for commitment of CD4 lineage, while its absence causes CD8 commitment. It als
• OMIM: 612533

Protein Summary

• Protein general information: O15156  
  • Name: Zinc finger and BTB domain containing protein 7B (Krueppel related zinc finger protein cKrox) (hcKrox) (T helper inducing POZ/Krueppel like factor) (Zinc finger and BTB domain containing protein 15) (Zinc finger protein 67 homolog) (Zfp 67) (Zinc finger p
  • Length: 539  
  • Mass: 58027
• Sequence:

  MGSPEDDLIGIPFPDHSSELLSCLNEQRQLGHLCDLTIRTQGLEYRTHRAVLAACSHYFKKLFTEGGGGAVMGAG
  GSGTATGGAGAGVCELDFVGPEALGALLEFAYTATLTTSSANMPAVLQAARLLEIPCVIAACMEILQGSGLEAPS
  PDEDDCERARQYLEAFATATASGVPNGEDSPPQVPLPPPPPPPPRPVARRSRKPRKAFLQTKGARANHLVPEVPT
  VPAHPLTYEEEEVAGRVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSP
  EELGSDEDAIDPDLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKIIHGAGKLPRHMRTHTGEKPFA
  CEVCGVRFTRNDKLKIHMRKHTGERPYSCPHCPARFLHSYDLKNHMHLHTGDRPYECHLCHKAFAKEDHLQRHLK
  GQNCLEVRTRRRRKDDAPPHYPPPSTAAASPAGLDLSNGHLDTFRLSLARFWEQSAPTGPPVSTPGPPDDDEEEG
  APTTPQAEGAMESS

• Structural information:
  • Protein Domains: (34..11-)
    (/note="BTB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00037"-)
  • Interpro: IPR000210  IPR011333  IPR036236  IPR013087  
  • Prosite: PS50097 PS00028 PS50157
  • STRING: ENSP00000406286
• Other Databases: GeneCards:  ZBTB7B  Malacards:  ZBTB7B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010628	positive regulation of gene expression	IBA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0060850	regulation of transcription involved in cell fate commitment	ISS	biological process
GO:0051141	negative regulation of NK T cell proliferation	ISS	biological process
GO:1990845	adaptive thermogenesis	ISS	biological process
GO:0090336	positive regulation of brown fat cell differentiation	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:2000640	positive regulation of SREBP signaling pathway	ISS	biological process
GO:0032868	response to insulin	ISS	biological process
GO:0007595	lactation	ISS	biological process
GO:0000987	cis-regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0031065	positive regulation of histone deacetylation	ISS	biological process
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:0072615	interleukin-17 secretion	ISS	biological process
GO:0001865	NK T cell differentiation	ISS	biological process
GO:0043372	positive regulation of CD4-positive, alpha-beta T cell differentiation	ISS	biological process
GO:0043377	negative regulation of CD8-positive, alpha-beta T cell differentiation	ISS	biological process
GO:0046628	positive regulation of insulin receptor signaling pathway	ISS	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0007398	ectoderm development	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0007595	lactation	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0051141	negative regulation of NK T cell proliferation	IEA	biological process
GO:0060850	regulation of transcription involved in cell fate commitment	IEA	biological process
GO:0090336	positive regulation of brown fat cell differentiation	IEA	biological process
GO:1990845	adaptive thermogenesis	IEA	biological process
GO:2000640	positive regulation of SREBP signaling pathway	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0000987	cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0001865	NK T cell differentiation	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0010468	regulation of gene expression	IEA	biological process
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0031065	positive regulation of histone deacetylation	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0042826	histone deacetylase binding	IEA	molecular function
GO:0043370	regulation of CD4-positive, alpha-beta T cell differentiation	IEA	biological process
GO:0043372	positive regulation of CD4-positive, alpha-beta T cell differentiation	IEA	biological process
GO:0043376	regulation of CD8-positive, alpha-beta T cell differentiation	IEA	biological process
GO:0043377	negative regulation of CD8-positive, alpha-beta T cell differentiation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0046628	positive regulation of insulin receptor signaling pathway	IEA	biological process
GO:0072615	interleukin-17 secretion	IEA	biological process
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:2000320	negative regulation of T-helper 17 cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq