• Gene id: 51042

Gene Summary

• Gene Symbol: ZNF593   Gene   UCSC   Ensembl
• Aliases: ZT86
• Gene name: zinc finger protein 593
• Alternate names: zinc finger protein 593, zinc finger protein T86,
• Gene location: 1p36.11 (26169907: 26170872)     Exons: 3     NC_000001.11
• OMIM: 604332

Protein Summary

• Protein general information: O00488  
  • Name: Zinc finger protein 593 (Zinc finger protein T86)
  • Length: 134  
  • Mass: 15199
  • Tissue specificity: Ubiquitous. Detected in spleen, prostate, testis, small intestine, colon and to a minor level in thymus and peripheral blood leukocytes.
• Sequence:

  MGRSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSTN
  LKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTST

• Structural information:
  • Interpro: IPR003604  IPR022755  IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • PDB: 1ZR9
  • PDBsum: 1ZR9
  • STRING: ENSP00000363384
• Other Databases: GeneCards:  ZNF593  Malacards:  ZNF593

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030687	preribosome, large subunit precursor	IBA	cellular component
GO:0043023	ribosomal large subunit binding	IBA	molecular function
GO:0000055	ribosomal large subunit export from nucleus	IBA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:1903026	negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding	IGI	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IGI	biological process
GO:0008270	zinc ion binding	IMP	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq