• Gene id: 5104

Gene Summary

• Gene Symbol: SERPINA5   Gene   UCSC   Ensembl
• Aliases: PAI-3, PAI3, PCI, PCI-B, PLANH3, PROCI
• Gene name: serpin family A member 5
• Alternate names: plasma serine protease inhibitor, acrosomal serine protease inhibitor, plasminogen activator inhibitor III, plasminogen activator inhibitor-3, protein C inhibitor, serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), m,
• Gene location: 14q32.13 (94581368: 94593119)     Exons: 6     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene is a member of the serpin family of proteins, a group of proteins that inhibit serine proteases. This gene is one in a cluster of serpin genes located on the q arm of chromosome 14. This family member is a glycoprotein tha
• OMIM: 601841

Protein Summary

• Protein general information: P05154  
  • Name: Plasma serine protease inhibitor (Acrosomal serine protease inhibitor) (Plasminogen activator inhibitor 3) (PAI 3) (PAI3) (Protein C inhibitor) (PCI) (Serpin A5)
  • Length: 406  
  • Mass: 45,675
• Sequence:

  MQLFLLLCLVLLSPQGASLHRHHPREMKKRVEDLHVGATVAPSSRRDFTFDLYRALASAAPSQSIFFSPVSISMS
  LAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMK
  TLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLLKNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYV
  TSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNATALFILPSEGKMQQVENGLSEKTLRKWLKMFKKRQLE
  LYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSA
  RLNSQRLVFNRPFLMFIVDNNILFLGKVNRP

• Structural information:
  • Interpro: IPR023795  IPR023796  IPR000215  IPR036186  
  • Prosite: PS00284
  • PDB: 1LQ8 1PAI 2HI9 2OL2 2PAI 3DY0
  • PDBsum: 1LQ8 1PAI 2HI9 2OL2 2PAI 3DY0
  • DIP: 29869
  • STRING: ENSP00000333203
• Other Databases: GeneCards:  SERPINA5  Malacards:  SERPINA5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001972	retinoic acid binding	IDA	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002080	acrosomal membrane	IDA	cellular component
GO:0002080	acrosomal membrane	IDA	cellular component
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005539	glycosaminoglycan binding	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0006869	lipid transport	IEA	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0007342	fusion of sperm to egg plasma membrane	NAS	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0008201	heparin binding	TAS	molecular function
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0031091	platelet alpha granule	IDA	cellular component
GO:0031094	platelet dense tubular network	IDA	cellular component
GO:0031210	phosphatidylcholine binding	IDA	molecular function
GO:0032190	acrosin binding	IPI	molecular function
GO:0036024	protein C inhibitor-TMPRSS7 complex	IDA	cellular component
GO:0036025	protein C inhibitor-TMPRSS11E complex	IDA	cellular component
GO:0036026	protein C inhibitor-PLAT complex	IDA	cellular component
GO:0036027	protein C inhibitor-PLAU complex	IDA	cellular component
GO:0036027	protein C inhibitor-PLAU complex	IDA	cellular component
GO:0036027	protein C inhibitor-PLAU complex	IDA	cellular component
GO:0036028	protein C inhibitor-thrombin complex	IDA	cellular component
GO:0036029	protein C inhibitor-KLK3 complex	IDA	cellular component
GO:0036030	protein C inhibitor-plasma kallikrein complex	IDA	cellular component
GO:0036030	protein C inhibitor-plasma kallikrein complex	IDA	cellular component
GO:0043234	protein complex	IDA	cellular component
GO:0043234	protein complex	IDA	cellular component
GO:0051346	negative regulation of hydrolase activity	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0097181	protein C inhibitor-coagulation factor V complex	IDA	cellular component
GO:0097182	protein C inhibitor-coagulation factor Xa complex	IDA	cellular component
GO:0097183	protein C inhibitor-coagulation factor XI complex	IDA	cellular component
GO:0001972	retinoic acid binding	IDA	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002080	acrosomal membrane	IDA	cellular component
GO:0002080	acrosomal membrane	IDA	cellular component
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005539	glycosaminoglycan binding	TAS	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0006810	transport	IEA	biological process
GO:0006869	lipid transport	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0007338	single fertilization	IEA	biological process
GO:0007342	fusion of sperm to egg plasma membrane	NAS	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0008201	heparin binding	TAS	molecular function
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0031091	platelet alpha granule	IDA	cellular component
GO:0031094	platelet dense tubular network	IDA	cellular component
GO:0031210	phosphatidylcholine binding	IDA	molecular function
GO:0032190	acrosin binding	IPI	molecular function
GO:0036024	protein C inhibitor-TMPRSS7 complex	IDA	cellular component
GO:0036025	protein C inhibitor-TMPRSS11E complex	IDA	cellular component
GO:0036026	protein C inhibitor-PLAT complex	IDA	cellular component
GO:0036027	protein C inhibitor-PLAU complex	IDA	cellular component
GO:0036027	protein C inhibitor-PLAU complex	IDA	cellular component
GO:0036027	protein C inhibitor-PLAU complex	IDA	cellular component
GO:0036028	protein C inhibitor-thrombin complex	IDA	cellular component
GO:0036029	protein C inhibitor-KLK3 complex	IDA	cellular component
GO:0036030	protein C inhibitor-plasma kallikrein complex	IDA	cellular component
GO:0036030	protein C inhibitor-plasma kallikrein complex	IDA	cellular component
GO:0043234	protein complex	IDA	cellular component
GO:0043234	protein complex	IDA	cellular component
GO:0045861	negative regulation of proteolysis	IEA	biological process
GO:0051346	negative regulation of hydrolase activity	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0097181	protein C inhibitor-coagulation factor V complex	IDA	cellular component
GO:0097182	protein C inhibitor-coagulation factor Xa complex	IDA	cellular component
GO:0097183	protein C inhibitor-coagulation factor XI complex	IDA	cellular component
GO:0001972	retinoic acid binding	IDA	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002080	acrosomal membrane	IDA	cellular component
GO:0002080	acrosomal membrane	IDA	cellular component
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005539	glycosaminoglycan binding	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0007283	spermatogenesis	ISS	biological process
GO:0007342	fusion of sperm to egg plasma membrane	NAS	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0008201	heparin binding	TAS	molecular function
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0031091	platelet alpha granule	IDA	cellular component
GO:0031094	platelet dense tubular network	IDA	cellular component
GO:0031210	phosphatidylcholine binding	IDA	molecular function
GO:0032190	acrosin binding	IPI	molecular function
GO:0036024	protein C inhibitor-TMPRSS7 complex	IDA	cellular component
GO:0036025	protein C inhibitor-TMPRSS11E complex	IDA	cellular component
GO:0036026	protein C inhibitor-PLAT complex	IDA	cellular component
GO:0036027	protein C inhibitor-PLAU complex	IDA	cellular component
GO:0036027	protein C inhibitor-PLAU complex	IDA	cellular component
GO:0036027	protein C inhibitor-PLAU complex	IDA	cellular component
GO:0036028	protein C inhibitor-thrombin complex	IDA	cellular component
GO:0036029	protein C inhibitor-KLK3 complex	IDA	cellular component
GO:0036030	protein C inhibitor-plasma kallikrein complex	IDA	cellular component
GO:0036030	protein C inhibitor-plasma kallikrein complex	IDA	cellular component
GO:0043234	protein complex	IDA	cellular component
GO:0043234	protein complex	IDA	cellular component
GO:0051346	negative regulation of hydrolase activity	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0097181	protein C inhibitor-coagulation factor V complex	IDA	cellular component
GO:0097182	protein C inhibitor-coagulation factor Xa complex	IDA	cellular component
GO:0097183	protein C inhibitor-coagulation factor XI complex	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04610	Complement and coagulation cascades

Diseases

Associated diseases	References
Teratozoospermia	MIK: 15377716
Male factor infertility	MIK: 10340997
Azoospermia	MIK: 15377716
Alpha 1-antitrypsin deficiency	GAD: 11161981
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Idiopathic azoospermia	MIK: 15377716
Low sperm motility	MIK: 21674046
Male infertility	MIK: 10340997
Spermatogenic defects	MIK: 17434507
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
10340997	Male infertility				Male infertility
15377716	Idiopathic azoospermia, teratozoospermia			95 (27 idiopathic azoospermia, 34 teratozoospermia, 34 normozoospermia)	Male infertility	PCI
10340997	Male infertility				Male infertility	PCI
17434507	Spermatogenic defects				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Low sperm motility			18	Male infertility	GSE26881
11120760	Impaired spermatogenesis				Male infertility