• Gene id: 51035

Gene Summary

• Gene Symbol: UBXN1   Gene   UCSC   Ensembl
• Aliases: 2B28, SAKS1, UBXD10
• Gene name: UBX domain protein 1
• Alternate names: UBX domain-containing protein 1, SAPK substrate protein 1, UBA/UBX 33.3 kDa protein,
• Gene location: 11q12.3 (62679116: 62676497)     Exons: 10     NC_000011.10
• OMIM: 606363

Protein Summary

• Protein general information: Q04323  
  • Name: UBX domain containing protein 1 (SAPK substrate protein 1) (UBA/UBX 33.3 kDa protein)
  • Length: 297  
  • Mass: 33325
• Sequence:

  MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHILGREPTSSEQGGLEGS
  GSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALERERQRRRQGQELSAARQRLQEDEMRRAAEER
  RREKAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTS
  LTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAKKCPS

• Structural information:
  • Protein Domains: (2..4-)
    (/note="UBA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00212-)
    (211..29-)
    (/note="UBX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00215"-)
  • Interpro: IPR015940  IPR009060  IPR041923  IPR029071  IPR001012  
  • Prosite: PS50030 PS50033
  • CDD: cd14302
  • DIP: 29467
  • STRING: ENSP00000294119
• Other Databases: GeneCards:  UBXN1  Malacards:  UBXN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000157	negative regulation of ubiquitin-specific protease activity	IDA	biological process
GO:1903094	negative regulation of protein K48-linked deubiquitination	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0036435	K48-linked polyubiquitin modification-dependent protein binding	IDA	molecular function
GO:1904293	negative regulation of ERAD pathway	IMP	biological process
GO:0051117	ATPase binding	IPI	molecular function
GO:0071796	K6-linked polyubiquitin modification-dependent protein binding	IDA	molecular function
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0031397	negative regulation of protein ubiquitination	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0031625	ubiquitin protein ligase binding	IDA	molecular function
GO:0034098	VCP-NPL4-UFD1 AAA ATPase complex	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:1904855	proteasome regulatory particle binding	IDA	molecular function
GO:0031593	polyubiquitin modification-dependent protein binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0051117	ATPase binding	IPI	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq