• Gene id: 51030

Gene Summary

• Gene Symbol: TVP23B   Gene   UCSC   Ensembl
• Aliases: CGI-148, FAM18B, FAM18B1, NPD008, YDR084C
• Gene name: trans-golgi network vesicle protein 23 homolog B
• Alternate names: Golgi apparatus membrane protein TVP23 homolog B, family with sequence similarity 18, member B, family with sequence similarity 18, member B1, protein FAM18B1,
• Gene location: 17p11.2 (18780994: 18806713)     Exons: 10     NC_000017.11
• OMIM: 0

Protein Summary

• Protein general information: Q9NYZ1  
  • Name: Golgi apparatus membrane protein TVP23 homolog B
  • Length: 205  
  • Mass: 23576
• Sequence:

  MLQQDSNDDTEDVSLFDAEEETTNRPRKAKIRHPVASFFHLFFRVSAIIVYLLCGLLSSSFITCMVTIILLLSCD
  FWAVKNVTGRLMVGLRWWNHIDEDGKSHWVFESRKESSQENKTVSEAESRIFWLGLIACPVLWVIFAFSALFSFR
  VKWLAVVIMGVVLQGANLYGYIRCKVRSRKHLTSMATSYFGKQFLRQNTGDDQTS

• Structural information:
  • Interpro: IPR008564  
  • STRING: ENSP00000305654
• Other Databases: GeneCards:  TVP23B  Malacards:  TVP23B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009306	protein secretion	IBA	biological process
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0030173	integral component of Golgi membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)