• Gene id: 51027

Gene Summary

• Gene Symbol: BOLA1   Gene   UCSC   Ensembl
• Aliases: CGI-143
• Gene name: bolA family member 1
• Alternate names: bolA-like protein 1, bolA homolog 1, bolA-like 1,
• Gene location: 1q21.2 (149899567: 149900794)     Exons: 2     NC_000001.11

Protein Summary

• Protein general information: Q9Y3E2  
  • Name: BolA like protein 1 (hBolA)
  • Length: 137  
  • Mass: 14289
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSS
  RFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP

• Structural information:
  • Interpro: IPR002634  IPR036065  
  • PDB: 5LCI
  • PDBsum: 5LCI
  • STRING: ENSP00000358149
• Other Databases: GeneCards:  BOLA1  Malacards:  BOLA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006351	transcription, DNA-templated	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component

Diseases

Associated diseases	References
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq