• Gene id: 51026

Gene Summary

• Gene Symbol: GOLT1B   Gene   UCSC   Ensembl
• Aliases: CGI-141, GCT2, GOT1, GOT1B, YMR292W
• Gene name: golgi transport 1B
• Alternate names: vesicle transport protein GOT1B, germ cell tumor 2, hGOT1a, putative NF-kappa-B-activating protein 470,
• Gene location: 12p12.1 (21501175: 21518407)     Exons: 6     NC_000012.12
• OMIM: 615078

Protein Summary

• Protein general information: Q9Y3E0  
  • Name: Vesicle transport protein GOT1B (Germ cell tumor 2) (Golgi transport 1 homolog B) (Putative NF kappa B activating protein 470) (hGOT1a)
  • Length: 138  
  • Mass: 15426
  • Tissue specificity: Widely expressed. Tends to be up-regulated in seminomas compared to normal testis. {ECO
• Sequence:

  MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKMKATGFFLGGV
  FVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKVGESNNMV

• Structural information:
  • Interpro: IPR007305  
  • STRING: ENSP00000229314
• Other Databases: GeneCards:  GOLT1B  Malacards:  GOLT1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	biological process
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)