• Gene id: 51024

Gene Summary

• Gene Symbol: FIS1   Gene   UCSC   Ensembl
• Aliases: CGI-135, TTC11
• Gene name: fission, mitochondrial 1
• Alternate names: mitochondrial fission 1 protein, FIS1 homolog, H_NH0132A01.6, TPR repeat protein 11, fission 1 (mitochondrial outer membrane) homolog, hFis1, mitochondrial fission molecule, tetratricopeptide repeat domain 11, tetratricopeptide repeat protein 11,
• Gene location: 7q22.1 (101245080: 101239471)     Exons: 5     NC_000007.14
• Gene summary(Entrez): The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM, Mar 2008]
• OMIM: 609003

Protein Summary

• Protein general information: Q9Y3D6  
  • Name: Mitochondrial fission 1 protein (FIS1 homolog) (hFis1) (Tetratricopeptide repeat protein 11) (TPR repeat protein 11)
  • Length: 152  
  • Mass: 16938
• Sequence:

  MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVF
  YLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKS
  KS

• Structural information:
  • Interpro: IPR016543  IPR033745  IPR028061  IPR028058  IPR011990  
  • CDD: cd12212
  • PDB: 1NZN 1PC2
  • PDBsum: 1NZN 1PC2
  • STRING: ENSP00000223136
• Other Databases: GeneCards:  FIS1  Malacards:  FIS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005777	peroxisome	ISS	cellular component
GO:0000422	autophagy of mitochondrion	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0005741	mitochondrial outer membrane	IBA	cellular component
GO:0005777	peroxisome	IBA	cellular component
GO:0005779	integral component of peroxisomal membrane	IBA	cellular component
GO:0006915	apoptotic process	IBA	biological process
GO:0031307	integral component of mitochondrial outer membrane	IBA	cellular component
GO:0000266	mitochondrial fission	IBA	biological process
GO:0016559	peroxisome fission	IBA	biological process
GO:0043653	mitochondrial fragmentation involved in apoptotic process	IBA	biological process
GO:0090314	positive regulation of protein targeting to membrane	IDA	biological process
GO:0090141	positive regulation of mitochondrial fission	IDA	biological process
GO:0005777	peroxisome	IDA	cellular component
GO:0008053	mitochondrial fusion	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000266	mitochondrial fission	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0070584	mitochondrion morphogenesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0014850	response to muscle activity	IEA	biological process
GO:0043653	mitochondrial fragmentation involved in apoptotic process	IEA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:1902617	response to fluoride	IEA	biological process
GO:1904579	cellular response to thapsigargin	IEA	biological process
GO:1905395	response to flavonoid	IEA	biological process
GO:0000266	mitochondrial fission	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0031307	integral component of mitochondrial outer membrane	IEA	cellular component
GO:0031667	response to nutrient levels	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0043525	positive regulation of neuron apoptotic process	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0071396	cellular response to lipid	IEA	biological process
GO:0090141	positive regulation of mitochondrial fission	IEA	biological process
GO:0097237	cellular response to toxic substance	IEA	biological process
GO:1901653	cellular response to peptide	IEA	biological process
GO:1990910	response to hypobaric hypoxia	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0016559	peroxisome fission	IDA	biological process
GO:0016559	peroxisome fission	IDA	biological process
GO:0000266	mitochondrial fission	IDA	biological process
GO:0000266	mitochondrial fission	IDA	biological process
GO:0005779	integral component of peroxisomal membrane	IDA	cellular component
GO:0005779	integral component of peroxisomal membrane	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0043653	mitochondrial fragmentation involved in apoptotic process	IDA	biological process
GO:0043653	mitochondrial fragmentation involved in apoptotic process	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0031307	integral component of mitochondrial outer membrane	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0000422	autophagy of mitochondrion	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0051561	positive regulation of mitochondrial calcium ion concentration	IMP	biological process
GO:0043653	mitochondrial fragmentation involved in apoptotic process	IMP	biological process
GO:0000266	mitochondrial fission	IMP	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0032471	negative regulation of endoplasmic reticulum calcium ion concentration	IMP	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001836	release of cytochrome c from mitochondria	IMP	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IMP	biological process
GO:0070584	mitochondrion morphogenesis	IMP	biological process
GO:0043653	mitochondrial fragmentation involved in apoptotic process	IMP	biological process
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0035584	calcium-mediated signaling using intracellular calcium source	IMP	biological process
GO:0016559	peroxisome fission	IMP	biological process
GO:0010821	regulation of mitochondrion organization	IMP	biological process
GO:0010821	regulation of mitochondrion organization	IMP	biological process
GO:0006626	protein targeting to mitochondrion	IMP	biological process
GO:0031307	integral component of mitochondrial outer membrane	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0042802	identical protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04137	Mitophagy - animal

Diseases

Associated diseases	References
Alzheimer's disease	PMID:19605646
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray