• Gene id: 51023

Gene Summary

• Gene Symbol: MRPS18C   Gene   UCSC   Ensembl
• Aliases: CGI-134, MRP-S18-1, MRP-S18-c, MRPS18-1, S18mt-c, mrps18-c
• Gene name: mitochondrial ribosomal protein S18C
• Alternate names: 28S ribosomal protein S18c, mitochondrial, 28S ribosomal protein S18-1, mitochondrial, mitochondrial ribosomal protein S18-1, mitochondrial small ribosomal subunit protein bS18c, mitochondrial small ribosomal subunit protein bS18m, mitochondrial small ribosoma,
• Gene location: 4q21.23 (17747717: 17788561)     Exons: 30     NC_000019.10
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611983

Protein Summary

• Protein general information: Q9Y3D5  
  • Name: 28S ribosomal protein S18c, mitochondrial (MRP S18 c) (Mrps18 c) (S18mt c) (28S ribosomal protein S18 1, mitochondrial) (MRP S18 1) (Mitochondrial small ribosomal subunit protein bS18c) (Mitochondrial small ribosomal subunit protein bS18m)
  • Length: 142  
  • Mass: 15850
• Sequence:

  MAAVVAVCGGLGRKKLTHLVTAAVSLTHPGTHTVLWRRGCSQQVSSNEDLPISMENPYKEPLKKCILCGKHVDYK
  NVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYRE

• Structural information:
  • Interpro: IPR001648  IPR018275  IPR036870  
  • Prosite: PS00057
  • PDB: 3J9M 6NU2 6NU3
  • PDBsum: 3J9M 6NU2 6NU3
  • STRING: ENSP00000295491
• Other Databases: GeneCards:  MRPS18C  Malacards:  MRPS18C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070181	small ribosomal subunit rRNA binding	IBA	molecular function
GO:0005763	mitochondrial small ribosomal subunit	IBA	cellular component
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0005763	mitochondrial small ribosomal subunit	IDA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005763	mitochondrial small ribosomal subunit	IDA	cellular component
GO:0006412	translation	NAS	biological process
GO:0003735	structural constituent of ribosome	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray