• Gene id: 51021

Gene Summary

• Gene Symbol: MRPS16   Gene   UCSC   Ensembl
• Aliases: CGI-132, COXPD2, MRP-S16, RPMS16
• Gene name: mitochondrial ribosomal protein S16
• Alternate names: 28S ribosomal protein S16, mitochondrial, S16mt, mitochondrial small ribosomal subunit protein bS16m,
• Gene location: 10q22.2 (73252643: 73248848)     Exons: 7     NC_000010.11
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 609204

Protein Summary

• Protein general information: Q9Y3D3  
  • Name: 28S ribosomal protein S16, mitochondrial (MRP S16) (S16mt) (Mitochondrial small ribosomal subunit protein bS16m)
  • Length: 137  
  • Mass: 15345
• Sequence:

  MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRH
  WIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET

• Structural information:
  • Interpro: IPR000307  IPR023803  
  • PDB: 3J9M 6NU2 6NU3
  • PDBsum: 3J9M 6NU2 6NU3
  • STRING: ENSP00000362036
• Other Databases: GeneCards:  MRPS16  Malacards:  MRPS16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005763	mitochondrial small ribosomal subunit	IBA	cellular component
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0015935	small ribosomal subunit	IBA	cellular component
GO:0005763	mitochondrial small ribosomal subunit	IDA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005763	mitochondrial small ribosomal subunit	IDA	cellular component
GO:0003735	structural constituent of ribosome	NAS	molecular function
GO:0006412	translation	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0032543	mitochondrial translation	ISS	biological process
GO:0003735	structural constituent of ribosome	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Combined oxidative phosphorylation deficiency	KEGG:H00891
Combined oxidative phosphorylation deficiency	KEGG:H00891
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881