• Gene id: 51018

Gene Summary

• Gene Symbol: RRP15   Gene   UCSC   Ensembl
• Aliases: CGI-115, KIAA0507
• Gene name: ribosomal RNA processing 15 homolog
• Alternate names: RRP15-like protein, ribosomal RNA-processing protein 15,
• Gene location: 1q41 (218285292: 218337982)     Exons: 6     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein that co-purifies with human nucleoli. A similar protein in budding yeast is a component of pre-60S ribosomal particles, and is required for the early maturation steps of the 60S subunit. [provided by RefSeq, Jul 2008]
• OMIM: 611193

Protein Summary

• Protein general information: Q9Y3B9  
  • Name: RRP15 like protein (Ribosomal RNA processing protein 15)
  • Length: 282  
  • Mass: 31484
• Sequence:

  MAAAAPDSRVSEEENLKKTPKKKMKMVTGAVASVLEDEATDTSDSEGSCGSEKDHFYSDDDAIEADSEGDAEPCD
  KENENDGESSVGTNMGWADAMAKVLNKKTPESKPTILVKNKKLEKEKEKLKQERLEKIKQRDKRLEWEMMCRVKP
  DVVQDKETERNLQRIATRGVVQLFNAVQKHQKNVDEKVKEAGSSMRKRAKLISTVSKKDFISVLRGMDGSTNETA
  SSRKKPKAKQTEVKSEEGPGWTILRDDFMMGASMKDWDKESDGPDDSRPESASDSDT

• Structural information:
  • Interpro: IPR012459  
  • STRING: ENSP00000355899
• Other Databases: GeneCards:  RRP15  Malacards:  RRP15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000470	maturation of LSU-rRNA	IBA	biological process
GO:0000460	maturation of 5.8S rRNA	IBA	biological process
GO:0030687	preribosome, large subunit precursor	IBA	cellular component
GO:0006364	rRNA processing	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray