• Gene id: 51003

Gene Summary

• Gene Symbol: MED31   Gene   UCSC   Ensembl
• Aliases: 3110004H13Rik, CGI-125, Soh1
• Gene name: mediator complex subunit 31
• Alternate names: mediator of RNA polymerase II transcription subunit 31, hSOH1, mediator complex subunit SOH1, mediator of RNA polymerase II transcription, subunit 31 homolog,
• Gene location: 17p13.1 (6651604: 6643310)     Exons: 6     NC_000017.11

Protein Summary

• Protein general information: Q9Y3C7  
  • Name: Mediator of RNA polymerase II transcription subunit 31 (Mediator complex subunit 31) (Mediator complex subunit SOH1) (hSOH1)
  • Length: 131  
  • Mass: 15805
• Sequence:

  MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHM
  LELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK

• Structural information:
  • Interpro: IPR038089  IPR008831  
  • STRING: ENSP00000225728
• Other Databases: GeneCards:  MED31  Malacards:  MED31

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0016592	mediator complex	IBA	cellular component
GO:0070847	core mediator complex	IBA	cellular component
GO:0016592	mediator complex	IEA	cellular component
GO:0003712	transcription coregulator activity	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060173	limb development	IEA	biological process
GO:0048147	negative regulation of fibroblast proliferation	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0000151	ubiquitin ligase complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881