Search Result
Gene id | 51000 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Symbol | SLC35B3 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Aliases | C6orf196, CGI-19, PAPST2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene name | solute carrier family 35 member B3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Alternate names | adenosine 3'-phospho 5'-phosphosulfate transporter 2, 3' phosphoadenosine 5' phosphosulfate transporter 2, PAPS transporter 2, solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B3, | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene location |
6p24.3 (8435566: 8411434) Exons: 14 NC_000006.12 |
||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene summary(Entrez) |
This gene is a member of the solute carrier family. The encoded protein is involved in the transport of 3-prime phosphoadenosine 5-prime phosphosulfate (PAPS) from the nucleus or the cytosol to the Golgi lumen. This gene has been reported to be expressed |
||||||||||||||||||||||||||||||||||||||||||||||||||||
OMIM | 610845 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein general information | Q9H1N7 Name: Adenosine 3' phospho 5' phosphosulfate transporter 2 (3' phosphoadenosine 5' phosphosulfate transporter) (PAPS transporter 2) (Solute carrier family 35 member B3) Length: 401 Mass: 44593 Tissue specificity: Preferentially and highly expressed in colon. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequence |
MDLTQQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNLSKF NKLTQFFICVAGVFVFYLIYGYLQELIFSVEGFKSCGWYLTLVQFAFYSIFGLIELQLIQDKRRRIPGKTYMIIA FLTVGTMGLSNTSLGYLNYPTQVIFKCCKLIPVMLGGVFIQGKRYNVADVSAAICMSLGLIWFTLADSTTAPNFN LTGVVLISLALCADAVIGNVQEKAMKLHNASNSEMVLYSYSIGFVYILLGLTCTSGLGPAVTFCAKNPVRTYGYA FLFSLTGYFGISFVLALIKIFGALIAVTVTTGRKAMTIVLSFIFFAKPFTFQYVWSGLLVVLGIFLNVYSKNMDK IRLPSLYDLINKSVEARKSRTLAQTV | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Databases | GeneCards: SLC35B3 Malacards: SLC35B3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontologyExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed referencesExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
|