• Gene id: 50999

Gene Summary

• Gene Symbol: TMED5   Gene   UCSC   Ensembl
• Aliases: CGI-100, p24g2, p28
• Gene name: transmembrane p24 trafficking protein 5
• Alternate names: transmembrane emp24 domain-containing protein 5, p24 family protein gamma-2, p24gamma2, transmembrane emp24 protein transport domain containing 5,
• Gene location: 1p22.1 (93180412: 93149741)     Exons: 6     NC_000001.11
• OMIM: 616876

Protein Summary

• Protein general information: Q9Y3A6  
  • Name: Transmembrane emp24 domain containing protein 5 (p24 family protein gamma 2) (p24gamma2) (p28)
  • Length: 229  
  • Mass: 26005
• Sequence:

  MGDKIWLPFPVLLLAALPPVLLPGAAGFTPSLDSDFTFTLPAGQKECFYQPMPLKASLEIEYQVLDGAGLDIDFH
  LASPEGKTLVFEQRKSDGVHTVETEVGDYMFCFDNTFSTISEKVIFFELILDNMGEQAQEQEDWKKYITGTDILD
  MKLEDILESINSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSMVNLVVMVVVSAIQVYMLKSLFEDKR
  KSRT

• Structural information:
  • Protein Domains: (45..12-)
    (/note="GOLD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00096"-)
  • Interpro: IPR009038  IPR036598  IPR015717  IPR015720  
  • Prosite: PS50866
  • STRING: ENSP00000359305
• Other Databases: GeneCards:  TMED5  Malacards:  TMED5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090161	Golgi ribbon formation	IBA	biological process
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0030134	COPII-coated ER to Golgi transport vesicle	IBA	cellular component
GO:0007030	Golgi organization	IBA	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005801	cis-Golgi network	IDA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IDA	cellular component
GO:0070971	endoplasmic reticulum exit site	IDA	cellular component
GO:0090161	Golgi ribbon formation	IMP	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IEA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray