• Gene id: 50937

Gene Summary

• Gene Symbol: CDON   Gene   UCSC   Ensembl
• Aliases: CDO, CDON1, HPE11, ORCAM
• Gene name: cell adhesion associated, oncogene regulated
• Alternate names: cell adhesion molecule-related/down-regulated by oncogenes, Cdon homolog, surface glycoprotein, Ig superfamily member,
• Gene location: 11q24.2 (126063334: 125956812)     Exons: 12     NC_000011.10
• Gene summary(Entrez): This gene encodes a cell surface receptor that is a member of the immunoglobulin superfamily. The encoded protein contains three fibronectin type III domains and five immunoglobulin-like C2-type domains. This protein is a member of a cell-surface receptor
• OMIM: 608707

Protein Summary

• Protein general information: Q4KMG0  
  • Name: Cell adhesion molecule related/down regulated by oncogenes
  • Length: 1287  
  • Mass: 139147
• Sequence:

  MHPDLGPLCTLLYVTLTILCSSVSSDLAPYFTSEPLSAVQKLGGPVVLHCSAQPVTTRISWLHNGKTLDGNLEHV
  KIHQGTLTILSLNSSLLGYYQCLANNSIGAIVSGPATVSVAVLGDFGSSTKHVITAEEKSAGFIGCRVPESNPKA
  EVRYKIRGKWLEHSTENYLILPSGNLQILNVSLEDKGSYKCAAYNPVTHQLKVEPIGRKLLVSRPSSDDVHILHP
  THSQALAVLSRSPVTLECVVSGVPAPQVYWLKDGQDIAPGSNWRRLYSHLATDSVDPADSGNYSCMAGNKSGDVK
  YVTYMVNVLEHASISKGLQDQIVSLGATVHFTCDVHGNPAPNCTWFHNAQPIHPSARHLTAGNGLKISGVTVEDV
  GMYQCVADNGIGFMHSTGRLEIENDGGFKPVIITAPVSAKVADGDFVTLSCNASGLPVPVIRWYDSHGLITSHPS
  QVLRSKSRKSQLSRPEGLNLEPVYFVLSQAGASSLHIQAVTQEHAGKYICEAANEHGTTQAEASLMVVPFETNTK
  AETVTLPDAAQNDDRSKRDGSETGLLSSFPVKVHPSAVESAPEKNASGISVPDAPIILSPPQTHTPDTYNLVWRA
  GKDGGLPINAYFVKYRKLDDGVGMLGSWHTVRVPGSENELHLAELEPSSLYEVLMVARSAAGEGQPAMLTFRTSK
  EKTASSKNTQASSPPVGIPKYPVVSEAANNNFGVVLTDSSRHSGVPEAPDRPTISTASETSVYVTWIPRANGGSP
  ITAFKVEYKRMRTSNWLVAAEDIPPSKLSVEVRSLEPGSTYKFRVIAINHYGESFRSSASRPYQVVGFPNRFSSR
  PITGPHIAYTEAVSDTQIMLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHMIGHLQPETSY
  DIKMQCFNEGGESEFSNVMICETKVKRVPGASEYPVKDLSTPPNSLGSGGNVGPATSPARSSDMLYLIVGCVLGV
  MVLILMVFIAMCLWKNRQQNTIQKYDPPGYLYQGSDMNGQMVDYTTLSGASQINGNVHGGFLTNGGLSSGYSHLH
  HKVPNAVNGIVNGSLNGGLYSGHSNSLTRTHVDFEHPHHLVNGGGMYTAVPQIDPLECVNCRNCRNNNRCFTKTN
  STFSSSPPPVVPVVAPYPQDGLEMKPLSHVKVPVCLTSAVPDCGQLPEESVKDNVEPVPTQRTCCQDIVNDVSSD
  GSEDPAEFSRGQEGMINLRIPDHLQLAKSCVWEGDSCAHSETEINIVSWNALILPPVPEGCAEKTMWSPPGIPLD
  SPTEVLQQPRET

• Structural information:
  • Protein Domains: (29..11-)
    1 (/note="Ig-like-C2-type)
    (120..20-)
    2 (/note="Ig-like-C2-type)
    (225..30-)
    3 (/note="Ig-like-C2-type)
    (310..39-)
    4 (/note="Ig-like-C2-type)
    (405..51-)
    5 (/note="Ig-like-C2-type)
    (579..67-)
    (/note="Fibron-)
  • Interpro: IPR032983  IPR003961  IPR036116  IPR007110  IPR036179   IPR013783  IPR013098  IPR003599  IPR003598  
  • Prosite: PS50853 PS50835
  • CDD: cd00063
  • PDB: 3D1M 3N1F 3N1Q
  • PDBsum: 3D1M 3N1F 3N1Q
  • DIP: 57226
  • STRING: ENSP00000376458
• Other Databases: GeneCards:  CDON  Malacards:  CDON

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048598	embryonic morphogenesis	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0007224	smoothened signaling pathway	IEA	biological process
GO:0045663	positive regulation of myoblast differentiation	IEA	biological process
GO:0045664	regulation of neuron differentiation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0051149	positive regulation of muscle cell differentiation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000179	positive regulation of neural precursor cell proliferation	IEA	biological process
GO:0060059	embryonic retina morphogenesis in camera-type eye	IEA	biological process
GO:0051146	striated muscle cell differentiation	IEA	biological process
GO:0048643	positive regulation of skeletal muscle tissue development	IEA	biological process
GO:0048598	embryonic morphogenesis	IEA	biological process
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0014816	skeletal muscle satellite cell differentiation	IEA	biological process
GO:0010172	embryonic body morphogenesis	IEA	biological process
GO:0009952	anterior/posterior pattern specification	IEA	biological process
GO:0002088	lens development in camera-type eye	IEA	biological process
GO:0051057	positive regulation of small GTPase mediated signal transduction	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045664	regulation of neuron differentiation	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0043393	regulation of protein binding	IEA	biological process
GO:0021987	cerebral cortex development	IEA	biological process
GO:0007520	myoblast fusion	IEA	biological process
GO:0007224	smoothened signaling pathway	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0001708	cell fate specification	IEA	biological process
GO:0062023	collagen-containing extracellular matrix	TAS	colocalizes with
GO:0005886	plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04340	Hedgehog signaling pathway

Diseases

Associated diseases	References
Holoprosencephaly	KEGG:H00267
Holoprosencephaly	KEGG:H00267
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq