• Gene id: 50862

Gene Summary

• Gene Symbol: RNF141   Gene   UCSC   Ensembl
• Aliases: RFP141, ZFP26, ZNF230
• Gene name: ring finger protein 141
• Alternate names: RING finger protein 141, C3HC4-like zinc finger protein, zinc finger protein 230,
• Gene location: 11p15 (10541186: 10511672)     Exons: 6     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. Abundant expression of this gene was found in the testicular tissue of fertile men, but was not detected in azoospermic
• OMIM: 616641

Protein Summary

• Protein general information: Q8WVD5  
  • Name: RING finger protein 141 (Zinc finger protein 230)
  • Length: 230  
  • Mass: 25535
  • Tissue specificity: Isoform 1 is testis-specific. Isoform 2 is expressed in heart, brain, skeletal muscle, kidney and pancreas. Isoform 1 is not expressed in fetus or in azoospermic patients. {ECO
• Sequence:

  MGQQISDQTQLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVASGQEKHLLFEVQPGSDSSAFWK
  VVVRVVCTKINKSSGIVEASRIMNLYQFIQLYKDITSQAAGVLAQSSTSEEPDENSSSVTSCQASLWMGRVKQLT
  DEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANESWVVSDAPTEDDMANYILNMADEAG
  QPHRP

• Structural information:
  • Interpro: IPR001841  IPR013083  IPR017907  
  • Prosite: PS00518 PS50089
  • PDB: 2ECN 5XEK
  • PDBsum: 2ECN 5XEK
  • STRING: ENSP00000265981
• Other Databases: GeneCards:  RNF141  Malacards:  RNF141

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004842	ubiquitin-protein transferase activity	IBA	molecular function
GO:0051865	protein autoubiquitination	IBA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R