• Gene id: 50861

Gene Summary

• Gene Symbol: STMN3   Gene   UCSC   Ensembl
• Aliases: SCLIP
• Gene name: stathmin 3
• Alternate names: stathmin-3, SCG10-like protein, stathmin-like 3,
• Gene location: 20q13.33 (6865732: 6898238)     Exons: 7     NC_000002.12
• Gene summary(Entrez): This gene encodes a protein which is a member of the stathmin protein family. Members of this protein family form a complex with tubulins at a ratio of 2 tubulins for each stathmin protein. Microtubules require the ordered assembly of alpha- and beta-tubu
• OMIM: 608362

Protein Summary

• Protein general information: Q9NZ72  
  • Name: Stathmin 3 (SCG10 like protein)
  • Length: 180  
  • Mass: 21017
  • Tissue specificity: Neuron specific.
• Sequence:

  MASTISAYKEKMKELSVLSLICSCFYTQPHPNTVYQYGDMEVKQLDKRASGQSFEVILKSPSDLSPESPMLSSPP
  KKKDTSLEELQKRLEAAEERRKTQEAQVLKQLAERREHEREVLHKALEENNNFSRQAEEKLNYKMELSKEIREAH
  LAALRERLREKELHAAEVRRNKEQREEMSG

• Structural information:
  • Protein Domains: (38..18-)
    (/note="SLD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00998"-)
  • Interpro: IPR028835  IPR030514  IPR000956  IPR036002  
  • Prosite: PS00563 PS01041 PS51663
  • STRING: ENSP00000359070
• Other Databases: GeneCards:  STMN3  Malacards:  STMN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035021	negative regulation of Rac protein signal transduction	ISS	biological process
GO:0031122	cytoplasmic microtubule organization	ISS	biological process
GO:0031175	neuron projection development	ISS	biological process
GO:0019904	protein domain specific binding	ISS	molecular function
GO:0051493	regulation of cytoskeleton organization	ISS	biological process
GO:0043087	regulation of GTPase activity	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0007019	microtubule depolymerization	IBA	biological process
GO:0015631	tubulin binding	IBA	molecular function
GO:0031110	regulation of microtubule polymerization or depolymerization	IBA	biological process
GO:0031175	neuron projection development	IBA	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0051493	regulation of cytoskeleton organization	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005829	cytosol	ISS	cellular component
GO:0015631	tubulin binding	IEA	molecular function
GO:0031110	regulation of microtubule polymerization or depolymerization	IEA	biological process
GO:0031122	cytoplasmic microtubule organization	IEA	biological process
GO:0031175	neuron projection development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007399	nervous system development	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051493	regulation of cytoskeleton organization	IEA	biological process
GO:0035021	negative regulation of Rac protein signal transduction	IEA	biological process
GO:0031175	neuron projection development	IEA	biological process
GO:0031122	cytoplasmic microtubule organization	IEA	biological process
GO:0001835	blastocyst hatching	IEA	biological process
GO:0043087	regulation of GTPase activity	IEA	biological process
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq