• Gene id: 50856

Gene Summary

• Gene Symbol: CLEC4A   Gene   UCSC   Ensembl
• Aliases: CD367, CLECSF6, DCIR, DDB27, HDCGC13P, LLIR
• Gene name: C-type lectin domain family 4 member A
• Alternate names: C-type lectin domain family 4 member A, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 6, C-type lectin DDB27, C-type lectin superfamily member 6, dendritic cell immunoreceptor, lectin-like immunoreceptor,
• Gene location: 12p13.31 (8102901: 8138606)     Exons: 10     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles
• OMIM: 601302

Protein Summary

• Protein general information: Q9UMR7  
  • Name: C type lectin domain family 4 member A (C type lectin DDB27) (C type lectin superfamily member 6) (Dendritic cell immunoreceptor) (Lectin like immunoreceptor) (CD antigen CD367)
  • Length: 237  
  • Mass: 27512
  • Tissue specificity: Expressed preferentially in hematopoietic tissues. Expressed in all circulating Ag-presenting cells such as dendritic cells, myeloid cells, monocytes, macrophages, B-cells and epidermal Langerhans cells (at protein level). Expressed in
• Sequence:

  MTSEITYAEVRFKNEFKSSGINTASSAASKERTAPHKSNTGFPKLLCASLLIFFLLLAISFFIAFVIFFQKYSQL
  LEKKTTKELVHTTLECVKKNMPVEETAWSCCPKNWKSFSSNCYFISTESASWQDSEKDCARMEAHLLVINTQEEQ
  DFIFQNLQEESAYFVGLSDPEGQRHWQWVDQTPYNESSTFWHPREPSDPNERCVVLNFRKSPKRWGWNDVNCLGP
  QRSVCEMMKIHL

• Structural information:
  • Protein Domains: (113..23-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR018378  IPR033989  IPR016187  
  • Prosite: PS00615 PS50041
  • CDD: cd03590
  • PDB: 5B1W 5B1X
  • PDBsum: 5B1W 5B1X
  • STRING: ENSP00000229332
• Other Databases: GeneCards:  CLEC4A  Malacards:  CLEC4A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IDA	molecular function
GO:0001818	negative regulation of cytokine production	IDA	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IDA	biological process
GO:0030246	carbohydrate binding	IDA	molecular function
GO:0005537	mannose binding	IDA	molecular function
GO:0042590	antigen processing and presentation of exogenous peptide antigen via MHC class I	IDA	biological process
GO:0036037	CD8-positive, alpha-beta T cell activation	IDA	biological process
GO:0002470	plasmacytoid dendritic cell antigen processing and presentation	IDA	biological process
GO:0002470	plasmacytoid dendritic cell antigen processing and presentation	IDA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881