• Gene id: 50852

Gene Summary

• Gene Symbol: TRAT1   Gene   UCSC   Ensembl
• Aliases: HSPC062, TCRIM, TRIM, pp29/30
• Gene name: T cell receptor associated transmembrane adaptor 1
• Alternate names: T-cell receptor-associated transmembrane adapter 1, T cell receptor interacting molecule,
• Gene location: 3q13.13 (108822785: 108855004)     Exons: 6     NC_000003.12
• OMIM: 193040

Protein Summary

• Protein general information: Q6PIZ9  
  • Name: T cell receptor associated transmembrane adapter 1 (T cell receptor interacting molecule) (TRIM) (pp29/30)
  • Length: 186  
  • Mass: 21211
  • Tissue specificity: Strongly expressed in thymus, and to a lesser extent in spleen, lymph node and peripheral blood lymphocytes. Present in T-cells and NK cells, but not B-cells (at protein level). {ECO
• Sequence:

  MSGISGCPFFLWGLLALLGLALVISLIFNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMD
  ENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKT
  TLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN

• Structural information:
  • Interpro: IPR020399  
  • STRING: ENSP00000295756
• Other Databases: GeneCards:  TRAT1  Malacards:  TRAT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002376	immune system process	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005068	transmembrane receptor protein tyrosine kinase adaptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006968	cellular defense response	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0051051	negative regulation of transport	IDA	biological process
GO:0050862	positive regulation of T cell receptor signaling pathway	IDA	biological process
GO:0050850	positive regulation of calcium-mediated signaling	IDA	biological process
GO:0042101	T cell receptor complex	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0001920	negative regulation of receptor recycling	IDA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0051897	positive regulation of protein kinase B signaling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R