• Gene id: 50848

Gene Summary

• Gene Symbol: F11R   Gene   UCSC   Ensembl
• Aliases: CD321, JAM, JAM1, JAMA, JCAM, KAT, PAM-1
• Gene name: F11 receptor
• Alternate names: junctional adhesion molecule A, junctional adhesion molecule 1, platelet F11 receptor, platelet adhesion molecule 1,
• Gene location: 1q23.3 (161021151: 160995210)     Exons: 10     NC_000001.11
• Gene summary(Entrez): Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space.
• OMIM: 613200

Protein Summary

• Protein general information: Q9Y624  
  • Name: Junctional adhesion molecule A (JAM A) (Junctional adhesion molecule 1) (JAM 1) (Platelet F11 receptor) (Platelet adhesion molecule 1) (PAM 1) (CD antigen CD321)
  • Length: 299  
  • Mass: 32583
  • Tissue specificity: Expressed in endothelium, epithelium and leukocytes (at protein level). {ECO
• Sequence:

  MGTKAQVERKLLCLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCY
  NNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIPSSATIGNRAV
  LTCSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTGELVFDPLSASDTGEYSCEARNGYGTPMTSN
  AVRMEAVERNVGVIVAAVLVTLILLGILVFGIWFAYSRGHFDRTKKGTSSKKVIYSQPSARSEGEFKQTSSFLV

• Structural information:
  • Protein Domains: (28..12-)
    1 (/note="Ig-like-V-type)
    (135..22-)
    2" (/note="Ig-like-V-type)
  • Interpro: IPR042456  IPR007110  IPR036179  IPR013783  IPR003599   IPR003598  IPR013106  
  • Prosite: PS50835
  • PDB: 1NBQ 3EOY 3TSZ 4ODB
  • PDBsum: 1NBQ 3EOY 3TSZ 4ODB
  • STRING: ENSP00000357005
• Other Databases: GeneCards:  F11R  Malacards:  F11R

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008360	regulation of cell shape	IDA	biological process
GO:0098609	cell-cell adhesion	IDA	biological process
GO:0035683	memory T cell extravasation	IDA	biological process
GO:0035025	positive regulation of Rho protein signal transduction	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:1901731	positive regulation of platelet aggregation	IDA	biological process
GO:0005178	integrin binding	IPI	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007159	leukocyte cell-cell adhesion	IMP	biological process
GO:0071260	cellular response to mechanical stimulus	IDA	biological process
GO:0032956	regulation of actin cytoskeleton organization	IDA	biological process
GO:1903142	positive regulation of establishment of endothelial barrier	IMP	biological process
GO:2000810	regulation of bicellular tight junction assembly	IMP	biological process
GO:0070160	tight junction	IMP	cellular component
GO:0035633	maintenance of blood-brain barrier	NAS	biological process
GO:1902396	protein localization to bicellular tight junction	IMP	biological process
GO:0051493	regulation of cytoskeleton organization	IMP	biological process
GO:0051497	negative regulation of stress fiber assembly	IMP	biological process
GO:0090557	establishment of endothelial intestinal barrier	IBA	biological process
GO:0005923	bicellular tight junction	IBA	cellular component
GO:0090559	regulation of membrane permeability	IBA	biological process
GO:0050892	intestinal absorption	IBA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0001618	virus receptor activity	IEA	molecular function
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006954	inflammatory response	TAS	biological process
GO:0005911	cell-cell junction	TAS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0070830	bicellular tight junction assembly	TAS	biological process
GO:0030054	cell junction	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007179	transforming growth factor beta receptor signaling pathway	TAS	biological process
GO:0030054	cell junction	TAS	cellular component
GO:0030054	cell junction	TAS	cellular component
GO:0030054	cell junction	TAS	cellular component
GO:0030054	cell junction	TAS	cellular component
GO:0030054	cell junction	TAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009314	response to radiation	IEA	biological process
GO:0090559	regulation of membrane permeability	IEA	biological process
GO:0050892	intestinal absorption	IEA	biological process
GO:0030855	epithelial cell differentiation	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0045777	positive regulation of blood pressure	IEA	biological process
GO:0036057	slit diaphragm	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0005911	cell-cell junction	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0001817	regulation of cytokine production	IEA	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0005923	bicellular tight junction	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0090557	establishment of endothelial intestinal barrier	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0034260	negative regulation of GTPase activity	IMP	biological process
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0090559	regulation of membrane permeability	IMP	biological process
GO:0050892	intestinal absorption	IMP	biological process
GO:0031032	actomyosin structure organization	IMP	biological process
GO:0090557	establishment of endothelial intestinal barrier	IGI	biological process
GO:2000249	regulation of actin cytoskeleton reorganization	IMP	biological process
GO:0043547	positive regulation of GTPase activity	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04530	Tight junction
hsa04514	Cell adhesion molecules
hsa04670	Leukocyte transendothelial migration
hsa05120	Epithelial cell signaling in Helicobacter pylori infection

Diseases

Associated diseases	References
Hypertension	PMID:18067551
Breast cancer	PMID:19533747
systemic scleroderma	PMID:19153103
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881