• Gene id: 50836

Gene Summary

• Gene Symbol: TAS2R8   Gene   UCSC   Ensembl
• Aliases: T2R8, TRB5
• Gene name: taste 2 receptor member 8
• Alternate names: taste receptor type 2 member 8, taste receptor, family B, member 5, taste receptor, type 2, member 8,
• Gene location: 12p13.2 (10807285: 10806050)     Exons: 1     NC_000012.12
• Gene summary(Entrez): This gene product belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organiz
• OMIM: 604794

Protein Summary

• Protein general information: Q9NYW2  
  • Name: Taste receptor type 2 member 8 (T2R8) (Taste receptor family B member 5) (TRB5)
  • Length: 309  
  • Mass: 35877
  • Tissue specificity: Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells.
• Sequence:

  MFSPADNIFIILITGEFILGILGNGYIALVNWIDWIKKKKISTVDYILTNLVIARICLISVMVVNGIVIVLNPDV
  YTKNKQQIVIFTFWTFANYLNMWITTCLNVFYFLKIASSSHPLFLWLKWKIDMVVHWILLGCFAISLLVSLIAAI
  VLSCDYRFHAIAKHKRNITEMFHVSKIPYFEPLTLFNLFAIVPFIVSLISFFLLVRSLWRHTKQIKLYATGSRDP
  STEVHVRAIKTMTSFIFFFFLYYISSILMTFSYLMTKYKLAVEFGEIAAILYPLGHSLILIVLNNKLRQTFVRML
  TCRKIACMI

• Structural information:
  • Interpro: IPR017452  IPR007960  
  • Prosite: PS50262
  • STRING: ENSP00000240615
• Other Databases: GeneCards:  TAS2R8  Malacards:  TAS2R8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0050909	sensory perception of taste	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process
GO:0033038	bitter taste receptor activity	IDA	molecular function
GO:0016021	integral component of membrane	IC	cellular component
GO:0008527	taste receptor activity	TAS	molecular function
GO:0033038	bitter taste receptor activity	IBA	molecular function
GO:0016021	integral component of membrane	IBA	cellular component
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IBA	biological process
GO:0050909	sensory perception of taste	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04742	Taste transduction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)