• Gene id: 50834

Gene Summary

• Gene Symbol: TAS2R1   Gene   UCSC   Ensembl
• Aliases: T2R1, TRB7
• Gene name: taste 2 receptor member 1
• Alternate names: taste receptor type 2 member 1, taste receptor, family B, member 7, taste receptor, type 2, member 1,
• Gene location: 5p15.31 (9630350: 9627346)     Exons: 1     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of a family of candidate taste receptors that are members of the G protein-coupled receptor superfamily and that are specifically expressed by taste receptor cells of the tongue and palate epithelia. This intronless taste recept
• OMIM: 612277

Protein Summary

• Protein general information: Q9NYW7  
  • Name: Taste receptor type 2 member 1 (T2R1) (Taste receptor family B member 7) (TRB7)
  • Length: 299  
  • Mass: 34333
  • Tissue specificity: Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells.
• Sequence:

  MLESHLIIYFLLAVIQFLLGIFTNGIIVVVNGIDLIKHRKMAPLDLLLSCLAVSRIFLQLFIFYVNVIVIFFIEF
  IMCSANCAILLFINELELWLATWLGVFYCAKVASVRHPLFIWLKMRISKLVPWMILGSLLYVSMICVFHSKYAGF
  MVPYFLRKFFSQNATIQKEDTLAIQIFSFVAEFSVPLLIFLFAVLLLIFSLGRHTRQMRNTVAGSRVPGRGAPIS
  ALLSILSFLILYFSHCMIKVFLSSLKFHIRRFIFLFFILVIGIYPSGHSLILILGNPKLKQNAKKFLLHSKCCQ

• Structural information:
  • Interpro: IPR007960  
  • STRING: ENSP00000371932
• Other Databases: GeneCards:  TAS2R1  Malacards:  TAS2R1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IBA	cellular component
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IBA	biological process
GO:0033038	bitter taste receptor activity	IBA	molecular function
GO:0050909	sensory perception of taste	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050896	response to stimulus	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0050909	sensory perception of taste	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0033038	bitter taste receptor activity	IDA	molecular function
GO:0016021	integral component of membrane	IC	cellular component
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process
GO:0008527	taste receptor activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04742	Taste transduction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R