• Gene id: 5082

Gene Summary

• Gene Symbol: PDCL   Gene   UCSC   Ensembl
• Aliases: PhLP
• Gene name: phosducin like
• Alternate names: phosducin-like protein,
• Gene location: 9q33.2 (122828587: 122818096)     Exons: 4     NC_000009.12
• Gene summary(Entrez): Phosducin-like protein is a putative modulator of heterotrimeric G proteins. The protein shares extensive amino acid sequence homology with phosducin, a phosphoprotein expressed in retina and pineal gland. Both phosducin-like protein and phosphoducin have
• OMIM: 604421

Protein Summary

• Protein general information: Q13371  
  • Name: Phosducin like protein (PHLP)
  • Length: 301  
  • Mass: 34282
• Sequence:

  MTTLDDKLLGEKLQYYYSSSEDEDSDHEDKDRGRCAPASSSVPAEAELAGEGISVNTGPKGVINDWRRFKQLETE
  QREEQCREMERLIKKLSMTCRSHLDEEEEQQKQKDLQEKISGKMTLKEFAIMNEDQDDEEFLQQYRKQRMEEMRQ
  QLHKGPQFKQVFEISSGEGFLDMIDKEQKSIVIMVHIYEDGIPGTEAMNGCMICLAAEYPAVKFCKVKSSVIGAS
  SQFTRNALPALLIYKGGELIGNFVRVTDQLGDDFFAVDLEAFLQEFGLLPEKEVLVLTSVRNSATCHSEDSDLEI
  D

• Structural information:
  • Interpro: IPR001200  IPR023196  IPR024253  IPR036249  
  • CDD: cd02987
  • STRING: ENSP00000259467
• Other Databases: GeneCards:  PDCL  Malacards:  PDCL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045880	positive regulation of smoothened signaling pathway	ISS	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0007601	visual perception	IEA	biological process
GO:0030030	cell projection organization	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0008277	regulation of G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006457	protein folding	IEA	biological process
GO:0007601	visual perception	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0061084	negative regulation of protein refolding	IEA	biological process
GO:0045880	positive regulation of smoothened signaling pathway	IEA	biological process
GO:1902605	heterotrimeric G-protein complex assembly	IEA	biological process
GO:0005929	cilium	IEA	cellular component
GO:0007165	signal transduction	NAS	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)