• Gene id: 50813

Gene Summary

• Gene Symbol: COPS7A   Gene   UCSC   Ensembl
• Aliases: CSN7, CSN7A, SGN7a
• Gene name: COP9 signalosome subunit 7A
• Alternate names: COP9 signalosome complex subunit 7a, COP9 complex subunit 7a, COP9 constitutive photomorphogenic homolog subunit 7A, JAB1-containing signalosome subunit 7a, dermal papilla-derived protein 10,
• Gene location: 12p13.31 (6724045: 6731867)     Exons: 9     NC_000012.12
• Gene summary(Entrez): This gene encodes a component of the COP9 signalosome, an evolutionarily conserved multi-subunit protease that regulates the activity of the ubiquitin conjugation pathway. Alternatively spliced transcript variants that encode the same protein have been de
• OMIM: 603856

Protein Summary

• Protein general information: Q9UBW8  
  • Name: COP9 signalosome complex subunit 7a (SGN7a) (Signalosome subunit 7a) (Dermal papilla derived protein 10) (JAB1 containing signalosome subunit 7a)
  • Length: 275  
  • Mass: 30277
  • Tissue specificity: Widely expressed. Expressed at high level in brain, heart and skeletal muscle. {ECO
• Sequence:

  MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTY
  ADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQ
  RLEVDYSIGRDIQRQDLSAIARTLQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKKTIKVTTA
  AAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN

• Structural information:
  • Protein Domains: (2..15-)
    (/note="PCI-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01185"-)
  • Interpro: IPR037757  IPR041481  IPR000717  
  • Prosite: PS50250
  • PDB: 4D10 4D18 4WSN
  • PDBsum: 4D10 4D18 4WSN
  • DIP: 53412
  • STRING: ENSP00000438115
• Other Databases: GeneCards:  COPS7A  Malacards:  COPS7A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008180	COP9 signalosome	IBA	cellular component
GO:0008180	COP9 signalosome	IDA	cellular component
GO:0000338	protein deneddylation	IDA	biological process
GO:0008180	COP9 signalosome	IEA	cellular component
GO:0010387	COP9 signalosome assembly	IEA	biological process
GO:0008180	COP9 signalosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0000715	nucleotide-excision repair, DNA damage recognition	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881