• Gene id: 50810

Gene Summary

• Gene Symbol: HDGFL3   Gene   UCSC   Ensembl
• Aliases: CGI-142, HDGF-2, HDGF2, HDGFRP3, HRP-3
• Gene name: HDGF like 3
• Alternate names: hepatoma-derived growth factor-related protein 3, hepatoma-derived growth factor 2, hepatoma-derived growth factor, related protein 3,
• Gene location: 15q25.2 (83207822: 83112737)     Exons: 7     NC_000015.10
• OMIM: 616643

Protein Summary

• Protein general information: Q9Y3E1  
  • Name: Hepatoma derived growth factor related protein 3 (HRP 3) (Hepatoma derived growth factor 2) (HDGF 2)
  • Length: 203  
  • Mass: 22620
  • Tissue specificity: Detected in testis, heart, spinal cord and brain. {ECO
• Sequence:

  MARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPYKEYKDKFGKS
  NKRKGFNEGLWEIENNPGVKFTGYQAIQQQSSSETEGEGGNTADASSEEEGDRVEEDGKGKRKNEKAGSKRKKSY
  TSKKSSKQSRKSPGDEDDKDCKEEENKSSSEGGDAGNDTRNTTSDLQKTSEGT

• Structural information:
  • Protein Domains: (11..6-)
    (/note="PWWP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00162"-)
  • Interpro: IPR035496  IPR000313  
  • Prosite: PS50812
  • CDD: cd05834
  • PDB: 6IIP 6IIQ 6IIR 6IIS 6IIT
  • PDBsum: 6IIP 6IIQ 6IIR 6IIS 6IIT
  • STRING: ENSP00000299633
• Other Databases: GeneCards:  HDGFL3  Malacards:  HDGFL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008017	microtubule binding	ISS	molecular function
GO:0005829	cytosol	ISS	cellular component
GO:0015631	tubulin binding	ISS	molecular function
GO:0031175	neuron projection development	ISS	biological process
GO:0046785	microtubule polymerization	ISS	biological process
GO:0007026	negative regulation of microtubule depolymerization	ISS	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0015631	tubulin binding	IEA	molecular function
GO:0031175	neuron projection development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007026	negative regulation of microtubule depolymerization	IEA	biological process
GO:0046785	microtubule polymerization	IEA	biological process
GO:0005576	extracellular region	HDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005634	nucleus	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)