• Gene id: 50801

Gene Summary

• Gene Symbol: KCNK4   Gene   UCSC   Ensembl
• Aliases: K2p4.1, TRAAK, TRAAK1
• Gene name: potassium two pore domain channel subfamily K member 4
• Alternate names: potassium channel subfamily K member 4, K2P4.1 potassium channel, TWIK-related arachidonic acid-stimulated potassium channel protein, potassium channel, subfamily K, member 4, potassium channel, two pore domain subfamily K, member 4, two pore K(+) channel,
• Gene location: 11q13.1 (64291301: 64300030)     Exons: 9     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the TWIK-related arachidonic acid-stimulated two pore potassium channel subfamily. The encoded protein homodimerizes and functions as an outwardly rectifying channel. This channel is regulated by polyunsaturated fatty acids,
• OMIM: 605720

Protein Summary

• Protein general information: Q9NYG8  
  • Name: Potassium channel subfamily K member 4 (TWIK related arachidonic acid stimulated potassium channel protein) (TRAAK) (Two pore potassium channel KT4.1) (Two pore K(+) channel KT4.1)
  • Length: 393  
  • Mass: 42,704
• Sequence:

  MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADP
  ETNSTSNSSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGI
  GHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPR
  QDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQAASWTGTVTARVTQRAGPAAPPPEKE
  QPLLPPPPCPAQPLGRPRSPSPPEKAQPPSPPTASALDYPSENLAFIDESSDTQSERGCPLPRAPRGRRRPNPPR
  KPVRPRGPGRPRDKGVPV

• Structural information:
  • Interpro: IPR003280  IPR008074  IPR013099  
  • PDB: 3UM7 4I9W 4RUE 4RUF 4WFE 4WFF 4WFG 4WFH
  • PDBsum: 3UM7 4I9W 4RUE 4RUF 4WFE 4WFF 4WFG 4WFH
  • DIP: 61343
  • STRING: ENSP00000378033
• Other Databases: GeneCards:  KCNK4  Malacards:  KCNK4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0005267	potassium channel activity	IDA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0006813	potassium ion transport	TAS	biological process
GO:0007613	memory	IEA	biological process
GO:0019233	sensory perception of pain	ISS	biological process
GO:0022841	potassium ion leak channel activity	IBA	molecular function
GO:0030322	stabilization of membrane potential	IBA	biological process
GO:0034705	potassium channel complex	IDA	cellular component
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0050951	sensory perception of temperature stimulus	ISS	biological process
GO:0050976	detection of mechanical stimulus involved in sensory perception of touch	ISS	biological process
GO:0071260	cellular response to mechanical stimulus	IDA	biological process
GO:0071398	cellular response to fatty acid	IDA	biological process
GO:0071469	cellular response to alkaline pH	ISS	biological process
GO:0071502	cellular response to temperature stimulus	ISS	biological process
GO:0071805	potassium ion transmembrane transport	IDA	biological process
GO:0097604	temperature-gated cation channel activity	ISS	molecular function
GO:0098782	mechanically-gated potassium channel activity	IDA	molecular function
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0005267	potassium channel activity	IEA	molecular function
GO:0005267	potassium channel activity	IEA	molecular function
GO:0005267	potassium channel activity	IEA	molecular function
GO:0005267	potassium channel activity	TAS	molecular function
GO:0005267	potassium channel activity	IDA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0006810	transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0006813	potassium ion transport	TAS	biological process
GO:0007613	memory	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019233	sensory perception of pain	IEA	biological process
GO:0019233	sensory perception of pain	ISS	biological process
GO:0022841	potassium ion leak channel activity	IBA	molecular function
GO:0030322	stabilization of membrane potential	IBA	biological process
GO:0034705	potassium channel complex	IDA	cellular component
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0050951	sensory perception of temperature stimulus	IEA	biological process
GO:0050951	sensory perception of temperature stimulus	ISS	biological process
GO:0050976	detection of mechanical stimulus involved in sensory perception of touch	IEA	biological process
GO:0050976	detection of mechanical stimulus involved in sensory perception of touch	ISS	biological process
GO:0071260	cellular response to mechanical stimulus	IDA	biological process
GO:0071398	cellular response to fatty acid	IEA	biological process
GO:0071398	cellular response to fatty acid	IDA	biological process
GO:0071469	cellular response to alkaline pH	IEA	biological process
GO:0071469	cellular response to alkaline pH	ISS	biological process
GO:0071502	cellular response to temperature stimulus	IEA	biological process
GO:0071502	cellular response to temperature stimulus	ISS	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IDA	biological process
GO:0097604	temperature-gated cation channel activity	IEA	molecular function
GO:0097604	temperature-gated cation channel activity	ISS	molecular function
GO:0098782	mechanically-gated potassium channel activity	IEA	molecular function
GO:0098782	mechanically-gated potassium channel activity	IDA	molecular function
GO:0005267	potassium channel activity	TAS	molecular function
GO:0005267	potassium channel activity	IDA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0006813	potassium ion transport	TAS	biological process
GO:0019233	sensory perception of pain	ISS	biological process
GO:0022841	potassium ion leak channel activity	IBA	molecular function
GO:0030322	stabilization of membrane potential	IBA	biological process
GO:0034705	potassium channel complex	IDA	cellular component
GO:0050951	sensory perception of temperature stimulus	ISS	biological process
GO:0050976	detection of mechanical stimulus involved in sensory perception of touch	ISS	biological process
GO:0071260	cellular response to mechanical stimulus	IDA	biological process
GO:0071398	cellular response to fatty acid	IDA	biological process
GO:0071469	cellular response to alkaline pH	ISS	biological process
GO:0071502	cellular response to temperature stimulus	ISS	biological process
GO:0071805	potassium ion transmembrane transport	IDA	biological process
GO:0097604	temperature-gated cation channel activity	ISS	molecular function
GO:0098782	mechanically-gated potassium channel activity	IDA	molecular function

Diseases

Associated diseases	References
Male factor infertility	MIK: 17928628
Azoospermia	MIK: 17928628
Azoospermia	MIK: 17928628
Spermatogenic defects	MIK: 31037746
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17928628	Azoospermia				Male infertility	CRISP1 SPINLW1 FAM12B DEFB129 CFTR AQP5 KCNK4 KCNK17 SLC6A20 SLC13A3 DEFB126 and DEFB106A
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray