• Gene id: 5074

Gene Summary

• Gene Symbol: PAWR   Gene   UCSC   Ensembl
• Aliases: PAR4, Par-4
• Gene name: pro-apoptotic WT1 regulator
• Alternate names: PRKC apoptosis WT1 regulator protein, PRKC, apoptosis, WT1, regulator, WT1-interacting protein, prostate apoptosis response protein 4, prostate apoptosis response protein PAR-4, prostate apoptosis response-4, transcriptional repressor PAR4,
• Gene location: 12q21.2 (74933115: 75050112)     Exons: 5     NC_000004.12
• Gene summary(Entrez): This gene encodes a tumor suppressor protein that selectively induces apoptosis in cancer cells through intracellular and extracellular mechanisms. The intracellular mechanism involves the inhibition of pro-survival pathways and the activation of Fas-medi
• OMIM: 601936

Protein Summary

• Protein general information: Q96IZ0  
  • Name: PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par 4)
  • Length: 340  
  • Mass: 36568
  • Tissue specificity: Widely expressed. Expression is elevated in various neurodegenerative diseases such as amyotrophic lateral sclerosis, Alzheimer, Parkinson and Huntington diseases and stroke. Down-regulated in several cancers. {ECO
• Sequence:

  MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELNNNLPG
  GAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSSGPSARKGKGQ
  IEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGR
  YKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMI
  GKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR

• Structural information:
  • Interpro: IPR026117  
  • PDB: 2JK9
  • PDBsum: 2JK9
  • DIP: 29003
  • STRING: ENSP00000328088
• Other Databases: GeneCards:  PAWR  Malacards:  PAWR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003714	transcription corepressor activity	TAS	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050860	negative regulation of T cell receptor signaling pathway	IEA	biological process
GO:0048147	negative regulation of fibroblast proliferation	IEA	biological process
GO:0042986	positive regulation of amyloid precursor protein biosynthetic process	IEA	biological process
GO:0042094	interleukin-2 biosynthetic process	IEA	biological process
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000790	nuclear chromatin	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:2000774	positive regulation of cellular senescence	IEA	biological process
GO:1901300	positive regulation of hydrogen peroxide-mediated programmed cell death	IEA	biological process
GO:0097190	apoptotic signaling pathway	IEA	biological process
GO:0042130	negative regulation of T cell proliferation	IEA	biological process
GO:0030889	negative regulation of B cell proliferation	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0019899	enzyme binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0051017	actin filament bundle assembly	ISS	biological process
GO:0043065	positive regulation of apoptotic process	NAS	biological process
GO:0006915	apoptotic process	ISS	biological process
GO:0003779	actin binding	ISS	molecular function
GO:0005884	actin filament	ISS	colocalizes with
GO:0005515	protein binding	IPI	molecular function
GO:0043522	leucine zipper domain binding	IPI	molecular function

Diseases

Associated diseases	References
Alzheimer's disease	PMID:9701251
Major depressive disorder	PMID:20067857
cholangiocarcinoma	PMID:20724592
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray