• Gene id: 5073

Gene Summary

• Gene Symbol: PARN   Gene   UCSC   Ensembl
• Aliases: DAN, DKCB6, PFBMFT4
• Gene name: poly(A)-specific ribonuclease
• Alternate names: poly(A)-specific ribonuclease PARN, deadenylating nuclease, deadenylation nuclease, polyadenylate-specific ribonuclease,
• Gene location: 16p13.12 (14630285: 14435700)     Exons: 27     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene is a 3'-exoribonuclease, with similarity to the RNase D family of 3'-exonucleases. It prefers poly(A) as the substrate, hence, efficiently degrades poly(A) tails of mRNAs. Exonucleolytic degradation of the poly(A) tail is
• OMIM: 604212

Protein Summary

• Protein general information: O95453  
  • Name: Poly(A) specific ribonuclease PARN (EC 3.1.13.4) (Deadenylating nuclease) (Deadenylation nuclease) (Polyadenylate specific ribonuclease)
  • Length: 639  
  • Mass: 73451
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFK
  YDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKR
  SQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGI
  HVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQF
  YCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQ
  LHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHV
  TFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRK
  WTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEP
  LSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW

• Structural information:
  • Protein Domains: (178..24-)
    (/note="R3H-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00382"-)
  • Interpro: IPR012677  IPR034042  IPR014789  IPR001374  IPR036867   IPR035979  IPR006941  IPR012337  IPR036397  
  • Prosite: PS51061
  • CDD: cd02637
  • PDB: 2A1R 2A1S 3CTR
  • PDBsum: 2A1R 2A1S 3CTR
  • DIP: 31124
  • STRING: ENSP00000387911
• Other Databases: GeneCards:  PARN  Malacards:  PARN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004535	poly(A)-specific ribonuclease activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	IBA	biological process
GO:0000175	3'-5'-exoribonuclease activity	IBA	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0010587	miRNA catabolic process	IDA	biological process
GO:0004535	poly(A)-specific ribonuclease activity	IDA	molecular function
GO:0071051	polyadenylation-dependent snoRNA 3'-end processing	IDA	biological process
GO:0000495	box H/ACA snoRNA 3'-end processing	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004535	poly(A)-specific ribonuclease activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006402	mRNA catabolic process	IEA	biological process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0004527	exonuclease activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0003730	mRNA 3'-UTR binding	TAS	molecular function
GO:0004518	nuclease activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0007292	female gamete generation	TAS	biological process
GO:0009451	RNA modification	TAS	biological process
GO:0004535	poly(A)-specific ribonuclease activity	IEA	molecular function
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070034	telomerase RNA binding	IC	molecular function
GO:0070034	telomerase RNA binding	IC	molecular function
GO:0004535	poly(A)-specific ribonuclease activity	IMP	molecular function
GO:0004535	poly(A)-specific ribonuclease activity	IMP	molecular function
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IMP	biological process
GO:0090669	telomerase RNA stabilization	IMP	biological process
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:0090669	telomerase RNA stabilization	IMP	biological process
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:0110008	ncRNA deadenylation	IMP	biological process
GO:1904872	regulation of telomerase RNA localization to Cajal body	IMP	biological process
GO:0110008	ncRNA deadenylation	IMP	biological process
GO:0051973	positive regulation of telomerase activity	IMP	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0043169	cation binding	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Dyskeratosis congenita	KEGG:H00507
Dyskeratosis congenita	KEGG:H00507
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq