• Gene id: 5071

Gene Summary

• Gene Symbol: PRKN   Gene   UCSC   Ensembl
• Aliases: AR-JP, LPRS2, PARK2, PDJ
• Gene name: parkin RBR E3 ubiquitin protein ligase
• Alternate names: E3 ubiquitin-protein ligase parkin, Parkinson disease (autosomal recessive, juvenile) 2, parkin, parkinson juvenile disease protein 2, parkinson protein 2 E3 ubiquitin protein ligase, parkinson protein 2, E3 ubiquitin protein ligase (parkin),
• Gene location: 6q26 (109548614: 109600194)     Exons: 9     NC_000001.11
• Gene summary(Entrez): The precise function of this gene is unknown; however, the encoded protein is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. Mutations in this gene are known to caus
• OMIM: 602544

Protein Summary

• Protein general information: O60260  
  • Name: E3 ubiquitin protein ligase parkin (Parkin) (EC 2.3.2.31) (Parkin RBR E3 ubiquitin protein ligase) (Parkinson juvenile disease protein 2) (Parkinson disease protein 2)
  • Length: 465  
  • Mass: 51641
  • Tissue specificity: Highly expressed in the brain including the substantia nigra. Expressed in heart, testis and skeletal muscle. Expression is down-regulated or absent in tumor biopsies, and absent in the brain of PARK2 patients. Overexpression protects
• Sequence:

  MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWR
  KGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYC
  KGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVA
  LHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKE
  LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEG
  ECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCG
  CEWNRVCMGDHWFDV

• Structural information:
  • Protein Domains: (1..7-)
    (/note="Ubiquitin-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00214"-)
  • Interpro: IPR031127  IPR002867  IPR003977  IPR041565  IPR000626   IPR029071  IPR041170  
  • Prosite: PS51873 PS50053
  • PDB: 1IYF 2JMO 4BM9 4I1F 4I1H 5C1Z 5C23 5C9V 5N2W 5N38 5TR5 6GLC 6HUE 6N13
  • PDBsum: 1IYF 2JMO 4BM9 4I1F 4I1H 5C1Z 5C23 5C9V 5N2W 5N38 5TR5 6GLC 6HUE 6N13
  • DIP: 37655
  • STRING: ENSP00000355865
• Other Databases: GeneCards:  PRKN  Malacards:  PRKN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:1903265	positive regulation of tumor necrosis factor-mediated signaling pathway	IDA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IC	biological process
GO:1903377	negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IDA	biological process
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	molecular function
GO:0097602	cullin family protein binding	IDA	molecular function
GO:0061734	parkin-mediated stimulation of mitophagy in response to mitochondrial depolarization	IDA	biological process
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0008013	beta-catenin binding	IDA	molecular function
GO:1901215	negative regulation of neuron death	IGI	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	NAS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0043388	positive regulation of DNA binding	IDA	biological process
GO:0031624	ubiquitin conjugating enzyme binding	IDA	molecular function
GO:2000378	negative regulation of reactive oxygen species metabolic process	IGI	biological process
GO:0043524	negative regulation of neuron apoptotic process	IDA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IDA	biological process
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:0001664	G protein-coupled receptor binding	IPI	molecular function
GO:0003779	actin binding	IPI	molecular function
GO:0008270	zinc ion binding	TAS	molecular function
GO:0061630	ubiquitin protein ligase activity	NAS	molecular function
GO:0061630	ubiquitin protein ligase activity	NAS	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0098779	positive regulation of mitophagy in response to mitochondrial depolarization	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0043005	neuron projection	IDA	cellular component
GO:0007005	mitochondrion organization	ISS	biological process
GO:0015631	tubulin binding	IPI	molecular function
GO:0015631	tubulin binding	IPI	molecular function
GO:1990381	ubiquitin-specific protease binding	IPI	molecular function
GO:0017124	SH3 domain binding	TAS	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0070534	protein K63-linked ubiquitination	IDA	biological process
GO:0099073	mitochondrion-derived vesicle	IDA	colocalizes with
GO:1902236	negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IDA	biological process
GO:1902236	negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IDA	biological process
GO:1902236	negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IDA	biological process
GO:0008344	adult locomotory behavior	ISS	biological process
GO:1903202	negative regulation of oxidative stress-induced cell death	TAS	biological process
GO:1903202	negative regulation of oxidative stress-induced cell death	NAS	biological process
GO:0035519	protein K29-linked ubiquitination	TAS	biological process
GO:1903542	negative regulation of exosomal secretion	IMP	biological process
GO:1902803	regulation of synaptic vesicle transport	NAS	biological process
GO:0090201	negative regulation of release of cytochrome c from mitochondria	IDA	biological process
GO:0010821	regulation of mitochondrion organization	IDA	biological process
GO:1903599	positive regulation of autophagy of mitochondrion	IDA	biological process
GO:0042417	dopamine metabolic process	TAS	biological process
GO:0070936	protein K48-linked ubiquitination	IDA	biological process
GO:0070936	protein K48-linked ubiquitination	IDA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0031648	protein destabilization	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0044257	cellular protein catabolic process	IMP	biological process
GO:0044314	protein K27-linked ubiquitination	TAS	biological process
GO:0044314	protein K27-linked ubiquitination	TAS	biological process
GO:0098779	positive regulation of mitophagy in response to mitochondrial depolarization	IMP	biological process
GO:0098779	positive regulation of mitophagy in response to mitochondrial depolarization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IMP	cellular component
GO:0051087	chaperone binding	IPI	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0051087	chaperone binding	IPI	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0097413	Lewy body	TAS	cellular component
GO:0070050	neuron cellular homeostasis	ISS	biological process
GO:0070534	protein K63-linked ubiquitination	NAS	biological process
GO:0070534	protein K63-linked ubiquitination	TAS	biological process
GO:1905366	negative regulation of intralumenal vesicle formation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019005	SCF ubiquitin ligase complex	IDA	NOT|cellular component
GO:0099074	mitochondrion to lysosome transport	IDA	biological process
GO:0014059	regulation of dopamine secretion	TAS	biological process
GO:1902236	negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IMP	biological process
GO:1902236	negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1905477	positive regulation of protein localization to membrane	IC	biological process
GO:0031396	regulation of protein ubiquitination	IGI	biological process
GO:0031396	regulation of protein ubiquitination	IMP	biological process
GO:0006513	protein monoubiquitination	IMP	biological process
GO:0006979	response to oxidative stress	ISS	biological process
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0044877	protein-containing complex binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0010636	positive regulation of mitochondrial fusion	IMP	biological process
GO:0010821	regulation of mitochondrion organization	NAS	biological process
GO:0010821	regulation of mitochondrion organization	IGI	biological process
GO:0042053	regulation of dopamine metabolic process	IMP	biological process
GO:1902254	negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator	IMP	biological process
GO:0045732	positive regulation of protein catabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990444	F-box domain binding	IPI	molecular function
GO:0043274	phospholipase binding	IPI	molecular function
GO:0030544	Hsp70 protein binding	IPI	molecular function
GO:0030544	Hsp70 protein binding	IPI	molecular function
GO:0031624	ubiquitin conjugating enzyme binding	IPI	molecular function
GO:0031624	ubiquitin conjugating enzyme binding	IPI	molecular function
GO:0031624	ubiquitin conjugating enzyme binding	IPI	molecular function
GO:0016567	protein ubiquitination	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:1903214	regulation of protein targeting to mitochondrion	NAS	biological process
GO:1903351	cellular response to dopamine	TAS	biological process
GO:1902530	positive regulation of protein linear polyubiquitination	IGI	biological process
GO:0034976	response to endoplasmic reticulum stress	IMP	biological process
GO:0036503	ERAD pathway	NAS	biological process
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IDA	biological process
GO:1900407	regulation of cellular response to oxidative stress	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:1990452	Parkin-FBXW7-Cul1 ubiquitin ligase complex	IPI	cellular component
GO:0051582	positive regulation of neurotransmitter uptake	IMP	biological process
GO:0000266	mitochondrial fission	ISS	biological process
GO:0032092	positive regulation of protein binding	IMP	biological process
GO:0032368	regulation of lipid transport	TAS	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0005739	mitochondrion	IMP	colocalizes with
GO:1904049	negative regulation of spontaneous neurotransmitter secretion	IMP	biological process
GO:1905281	positive regulation of retrograde transport, endosome to Golgi	NAS	biological process
GO:1905477	positive regulation of protein localization to membrane	IMP	biological process
GO:0010906	regulation of glucose metabolic process	TAS	biological process
GO:0010994	free ubiquitin chain polymerization	IMP	biological process
GO:0016567	protein ubiquitination	IMP	biological process
GO:1902283	negative regulation of primary amine oxidase activity	IMP	biological process
GO:0046329	negative regulation of JNK cascade	ISS	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0060828	regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0090141	positive regulation of mitochondrial fission	ISS	biological process
GO:0097237	cellular response to toxic substance	IMP	biological process
GO:1900407	regulation of cellular response to oxidative stress	IMP	biological process
GO:1900407	regulation of cellular response to oxidative stress	ISS	biological process
GO:0034620	cellular response to unfolded protein	TAS	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0010637	negative regulation of mitochondrial fusion	ISS	biological process
GO:1901800	positive regulation of proteasomal protein catabolic process	IGI	biological process
GO:0055069	zinc ion homeostasis	ISS	biological process
GO:0071287	cellular response to manganese ion	TAS	biological process
GO:0085020	protein K6-linked ubiquitination	TAS	biological process
GO:0031647	regulation of protein stability	IMP	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0000151	ubiquitin ligase complex	IBA	cellular component
GO:0001933	negative regulation of protein phosphorylation	IBA	biological process
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0010821	regulation of mitochondrion organization	IBA	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0000422	autophagy of mitochondrion	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0031624	ubiquitin conjugating enzyme binding	IBA	molecular function
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:1900407	regulation of cellular response to oxidative stress	IBA	biological process
GO:0070979	protein K11-linked ubiquitination	IDA	biological process
GO:0070534	protein K63-linked ubiquitination	IDA	biological process
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0000422	autophagy of mitochondrion	IDA	biological process
GO:0085020	protein K6-linked ubiquitination	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0000423	mitophagy	IDA	biological process
GO:0070936	protein K48-linked ubiquitination	IDA	biological process
GO:0070534	protein K63-linked ubiquitination	IDA	biological process
GO:0010506	regulation of autophagy	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:0031648	protein destabilization	IDA	biological process
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0006513	protein monoubiquitination	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000422	autophagy of mitochondrion	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0016567	protein ubiquitination	IMP	biological process
GO:0005739	mitochondrion	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000422	autophagy of mitochondrion	IMP	biological process
GO:0000422	autophagy of mitochondrion	IMP	biological process
GO:0016567	protein ubiquitination	IMP	biological process
GO:0004842	ubiquitin-protein transferase activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0006914	autophagy	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007417	central nervous system development	TAS	biological process
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0046676	negative regulation of insulin secretion	IDA	biological process
GO:0033132	negative regulation of glucokinase activity	IDA	biological process
GO:0019900	kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0044828	negative regulation by host of viral genome replication	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0061630	ubiquitin protein ligase activity	TAS	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903382	negative regulation of endoplasmic reticulum stress-induced neuron intrinsic apoptotic signaling pathway	IEA	biological process
GO:1903377	negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IEA	biological process
GO:1902236	negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IEA	biological process
GO:1901215	negative regulation of neuron death	IEA	biological process
GO:0070585	protein localization to mitochondrion	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0051583	dopamine uptake involved in synaptic transmission	IEA	biological process
GO:0046928	regulation of neurotransmitter secretion	IEA	biological process
GO:0044257	cellular protein catabolic process	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0042417	dopamine metabolic process	IEA	biological process
GO:0042415	norepinephrine metabolic process	IEA	biological process
GO:0035249	synaptic transmission, glutamatergic	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0031648	protein destabilization	IEA	biological process
GO:0019538	protein metabolic process	IEA	biological process
GO:0008344	adult locomotory behavior	IEA	biological process
GO:0007626	locomotory behavior	IEA	biological process
GO:0001964	startle response	IEA	biological process
GO:0001963	synaptic transmission, dopaminergic	IEA	biological process
GO:0000423	mitophagy	IEA	biological process
GO:1903861	positive regulation of dendrite extension	IEA	biological process
GO:1902530	positive regulation of protein linear polyubiquitination	IEA	biological process
GO:0097237	cellular response to toxic substance	IEA	biological process
GO:0051881	regulation of mitochondrial membrane potential	IEA	biological process
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0034976	response to endoplasmic reticulum stress	IEA	biological process
GO:0007612	learning	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0010498	proteasomal protein catabolic process	IMP	biological process
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0001933	negative regulation of protein phosphorylation	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0016235	aggresome	IDA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0060548	negative regulation of cell death	IDA	biological process
GO:0070534	protein K63-linked ubiquitination	IDA	biological process
GO:0090201	negative regulation of release of cytochrome c from mitochondria	IDA	biological process
GO:0070842	aggresome assembly	IMP	biological process
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0032232	negative regulation of actin filament bundle assembly	IDA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IDA	biological process
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000377	regulation of reactive oxygen species metabolic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05012	Parkinson disease
hsa04141	Protein processing in endoplasmic reticulum
hsa04120	Ubiquitin mediated proteolysis
hsa04137	Mitophagy - animal

Diseases

Associated diseases	References
Parkinson disease	KEGG:H00057
Parkinsonian syndrome	KEGG:H01600
Parkinson disease	KEGG:H00057
Parkinsonian syndrome	KEGG:H01600
Alzheimer's disease	PMID:19716418
Lewy body dementia	PMID:17467279
Parkinson's disease	PMID:20823226
Parkinson's disease	PMID:16914382
Multiple sclerosis	PMID:19716418
cervical cancer	PMID:28631565
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray