• Gene id: 5068

Gene Summary

• Gene Symbol: REG3A   Gene   UCSC   Ensembl
• Aliases: HIP, HIP/PAP, INGAP, PAP, PAP-H, PAP1, PBCGF, REG-III, REG3
• Gene name: regenerating family member 3 alpha
• Alternate names: regenerating islet-derived protein 3-alpha, PAP homologous protein, REG-3-alpha, hepatocarcinoma-intestine-pancreas, hepatointestinal pancreatic protein, human proislet peptide, pancreatic beta cell growth factor, pancreatitis-associated protein 1, proliferation-,
• Gene location: 2p12 (79159752: 79157005)     Exons: 6     NC_000002.12
• Gene summary(Entrez): This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver c
• OMIM: 167805

Protein Summary

• Protein general information: Q06141  
  • Name: Regenerating islet derived protein 3 alpha (REG 3 alpha) (Hepatointestinal pancreatic protein) (HIP/PAP) (Human proislet peptide) (Pancreatitis associated protein 1) (Regenerating islet derived protein III alpha) (Reg III alpha) [Cleaved into: Regeneratin
  • Length: 175  
  • Mass: 19395
  • Tissue specificity: Highly expressed in epidermal keratinocytes of psoriasis patients (at protein level). Constitutively expressed in intestine. Low expression is found in healthy pancreas. Overexpressed during the acute phase of pancreatitis and in some
• Sequence:

  MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGN
  LVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLS
  RSTAFLRWKDYNCNVRLPYVCKFTD

• Structural information:
  • Protein Domains: (47..17-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR018378  IPR016187  
  • Prosite: PS00615 PS50041
  • PDB: 1UV0 2GO0 4MTH
  • PDBsum: 1UV0 2GO0 4MTH
  • DIP: 60688
  • STRING: ENSP00000377456
• Other Databases: GeneCards:  REG3A  Malacards:  REG3A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IBA	biological process
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0008284	positive regulation of cell population proliferation	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0070492	oligosaccharide binding	IBA	molecular function
GO:0044278	cell wall disruption in other organism	IBA	biological process
GO:0043434	response to peptide hormone	IBA	biological process
GO:0042834	peptidoglycan binding	IBA	molecular function
GO:0090303	positive regulation of wound healing	ISS	biological process
GO:0045617	negative regulation of keratinocyte differentiation	ISS	biological process
GO:0010838	positive regulation of keratinocyte proliferation	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006953	acute-phase response	IEA	biological process
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0030246	carbohydrate binding	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0019730	antimicrobial humoral response	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
hepatocellular carcinoma	PMID:10550309
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)