• Gene id: 50651

Gene Summary

• Gene Symbol: SLC45A1   Gene   UCSC   Ensembl
• Aliases: DNB5, IDDNPF, PAST-A
• Gene name: solute carrier family 45 member 1
• Alternate names: proton-associated sugar transporter A, H+/sugar symporter, deleted in neuroblastoma 5 protein,
• Gene location: 1p36.23 (8318107: 8344166)     Exons: 9     NC_000001.11
• Gene summary(Entrez): This gene was isolated initially from a region on chromosome 1p that is frequently deleted in human neuroblastoma, although no causal relationship has since been demonstrated. The encoded protein belongs to the glycoside-pentoside-hexuronide cation sympor
• OMIM: 604999

Protein Summary

• Protein general information: Q9Y2W3  
  • Name: Proton associated sugar transporter A (PAST A) (Deleted in neuroblastoma 5 protein) (DNb 5) (Solute carrier family 45 member 1)
  • Length: 782  
  • Mass: 84541
  • Tissue specificity: Expressed in adult heart, brain, muscle and kidney, with very strong expression in brain. Also expressed in fetal brain, kidney and lung. {ECO
• Sequence:

  MLQQPGPRPGRQQPSGDRDACRLHPQGRPPALPTMIPAASSTPPGDALFPSVAPQDFWRSQVTGYSGSVTRHLSH
  RANNFKRHPKRRKCIRPSPPPPPNTPCPLELVDFGDLHPQRSFRELLFNGCILFGIEFSYAMETAYVTPVLLQMG
  LPDQLYSLVWFISPILGFLLQPLLGAWSDRCTSRFGRRRPFILVLAIGALLGLSLLLNGRDIGIALADVTGNHKW
  GLLLTVCGVVLMDFSADSADNPSHAYMMDVCSPADQDRGLNIHALLAGLGGGFGYVVGGIHWDKTGFGRALGGQL
  RVIYLFTAVTLSVTTVLTLVSIPERPLRPPSEKRAAMKSPSLPLPPSPPVLPEEGPGDSLPSHTATNFSSPISPP
  SPLTPKYGSFISRDSSLTGISEFASSFGTANIDSVLIDCFTGGHDSYLAIPGSVPRPPISVSFPRAPDGFYRQDR
  GLLEGREGALTSGCDGDILRVGSLDTSKPRSSGILKRPQTLAIPDAAGGGGPETSRRRNVTFSQQVANILLNGVK
  YESELTGSSERAEQPLSVGRLCSTICNMPKALRTLCVNHFLGWLSFEGMLLFYTDFMGEVVFQGDPKAPHTSEAY
  QKYNSGVTMGCWGMCIYAFSAAFYSAILEKLEEFLSVRTLYFIAYLAFGLGTGLATLSRNLYVVLSLCITYGILF
  STLCTLPYSLLCDYYQSKKFAGSSADGTRRGMGVDISLLSCQYFLAQILVSLVLGPLTSAVGSANGVMYFSSLVS
  FLGCLYSSLFVIYEIPPSDAADEEHRPLLLNV

• Structural information:
  • Interpro: IPR011701  IPR036259  
  • STRING: ENSP00000289877
• Other Databases: GeneCards:  SLC45A1  Malacards:  SLC45A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008506	sucrose:proton symporter activity	IBA	molecular function
GO:0016020	membrane	IBA	cellular component
GO:1904659	glucose transmembrane transport	IMP	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0008643	carbohydrate transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015770	sucrose transport	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq