• Gene id: 5064

Gene Summary

• Gene Symbol: PALM   Gene   UCSC   Ensembl
• Aliases: PALM1
• Gene name: paralemmin
• Alternate names: paralemmin-1,
• Gene location: 19p13.3 (708934: 748328)     Exons: 11     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the paralemmin protein family. The product of this gene is a prenylated and palmitoylated phosphoprotein that associates with the cytoplasmic face of plasma membranes and is implicated in plasma membrane dynamics in neurons a
• OMIM: 605399

Protein Summary

• Protein general information: O75781  
  • Name: Paralemmin 1 (Paralemmin)
  • Length: 387  
  • Mass: 42076
  • Tissue specificity: Widely expressed with highest expression in brain and testis and intermediate expression in heart and adrenal gland.
• Sequence:

  MEVLAAETTSQQERLQAIAEKRKRQAEIENKRRQLEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQ
  DDEQKTRLLEDSVSRLEKEIEVLERGDSAPATAKENAAAPSPVRAPAPSPAKEERKTEVVMNSQQTPVGTPKDKR
  VSNTPLRTVDGSPMMKAAMYSVEITVEKDKVTGETRVLSSTTLLPRQPLPLGIKVYEDETKVVHAVDGTAENGIH
  PLSSSEVDELIHKADEVTLSEAGSTAGAAETRGAVEGAARTTPSRREITGVQAQPGEATSGPPGIQPGQEPPVTM
  IFMGYQNVEDEAETKKVLGLQDTITAELVVIEDAAEPKEPAPPNGSAAEPPTEAASREENQAGPEATTSDPQDLD
  MKKHRCKCCSIM

• Structural information:
  • Interpro: IPR004965  
  • STRING: ENSP00000341911
• Other Databases: GeneCards:  PALM  Malacards:  PALM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051491	positive regulation of filopodium assembly	IBA	biological process
GO:0007194	negative regulation of adenylate cyclase activity	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0060160	negative regulation of dopamine receptor signaling pathway	IDA	biological process
GO:0051491	positive regulation of filopodium assembly	IDA	biological process
GO:0031527	filopodium membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0031235	intrinsic component of the cytoplasmic side of the plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008360	regulation of cell shape	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0008360	regulation of cell shape	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0031410	cytoplasmic vesicle	TAS	cellular component
GO:0007010	cytoskeleton organization	IEA	biological process
GO:0008360	regulation of cell shape	IEA	biological process
GO:0030175	filopodium	IEA	cellular component
GO:0031750	D3 dopamine receptor binding	IEA	molecular function
GO:0072659	protein localization to plasma membrane	IEA	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0032591	dendritic spine membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007194	negative regulation of adenylate cyclase activity	IEA	biological process
GO:0008104	protein localization	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0044309	neuron spine	IEA	cellular component
GO:0060074	synapse maturation	IEA	biological process
GO:0071257	cellular response to electrical stimulus	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016327	apicolateral plasma membrane	IEA	cellular component
GO:0032590	dendrite membrane	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0031527	filopodium membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0016327	apicolateral plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq