• Gene id: 50632

Gene Summary

• Gene Symbol: CALY   Gene   UCSC   Ensembl
• Aliases: DRD1IP, NSG3
• Gene name: calcyon neuron specific vesicular protein
• Alternate names: neuron-specific vesicular protein calcyon, D1 dopamine receptor-interacting protein, calcyon D1 dopamine receptor-interacting protein (CALCYON), calcyon protein, dopamine receptor D1 interacting protein,
• Gene location: 10q26.3 (133336895: 133324071)     Exons: 9     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is a type II single transmembrane protein. It is required for maximal stimulated calcium release after stimulation of purinergic or muscarinic but not beta-adrenergic receptors. The encoded protein interacts with D1 dopami
• OMIM: 604704

Protein Summary

• Protein general information: Q9NYX4  
  • Name: Neuron specific vesicular protein calcyon
  • Length: 217  
  • Mass: 23434
  • Tissue specificity: Expressed in the pyramidal cells of the prefrontal cortex, in hippothalamus and in caudate nucleus. No expression in spleen. Up-regulated in the prefrontal cortex of schizophrenic patients with nearly twice the levels of non-schizophre
• Sequence:

  MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQRLNCS
  HPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPERHRSILAAIGA
  YPLSRKHGTETPAAWGDGYRAAKEERKGPTQAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ

• Structural information:
  • Interpro: IPR009431  
  • STRING: ENSP00000252939
• Other Databases: GeneCards:  CALY  Malacards:  CALY

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032051	clathrin light chain binding	IBA	molecular function
GO:0005768	endosome	IBA	cellular component
GO:0048268	clathrin coat assembly	IBA	biological process
GO:0016197	endosomal transport	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0007212	dopamine receptor signaling pathway	IEA	biological process
GO:0032051	clathrin light chain binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0048268	clathrin coat assembly	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0098884	postsynaptic neurotransmitter receptor internalization	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0032051	clathrin light chain binding	IDA	molecular function
GO:0048268	clathrin coat assembly	IDA	biological process
GO:0045807	positive regulation of endocytosis	IMP	biological process
GO:0098843	postsynaptic endocytic zone	IMP	cellular component
GO:0098843	postsynaptic endocytic zone	IDA	cellular component
GO:0098843	postsynaptic endocytic zone	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04728	Dopaminergic synapse

Diseases

Associated diseases	References
Attention deficit hyperactivity disorder	PMID:16172615
Schizophrenia	PMID:12622665
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq