• Gene id: 50615

Gene Summary

• Gene Symbol: IL21R   Gene   UCSC   Ensembl
• Aliases: CD360, IMD56, NILR
• Gene name: interleukin 21 receptor
• Alternate names: interleukin-21 receptor, IL-21 receptor, novel interleukin receptor,
• Gene location: 16p12.1 (27402161: 27452042)     Exons: 12     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene is a cytokine receptor for interleukin 21 (IL21). It belongs to the type I cytokine receptors, and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the
• OMIM: 605383

Protein Summary

• Protein general information: Q9HBE5  
  • Name: Interleukin 21 receptor (IL 21 receptor) (IL 21R) (Novel interleukin receptor) (CD antigen CD360)
  • Length: 538  
  • Mass: 59130
  • Tissue specificity: Selectively expressed in lymphoid tissues. Most highly expressed in thymus and spleen.
• Sequence:

  MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNAT
  HATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYML
  KGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQT
  QSEELKEGWNPHLLLLLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSS
  LELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVS
  IDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLDAGTTVLSCGCVSAGSPGLGGPLGSLLDRLK
  PPLADGEDWAGGLPWGGRSPGGVSESEAGSPLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVV
  IPPPLSSPGPQAS

• Structural information:
  • Protein Domains: (21..11-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (119..22-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"-)
  • Interpro: IPR003961  IPR036116  IPR003531  IPR013783  
  • Prosite: PS50853 PS01355
  • CDD: cd00063
  • PDB: 3TGX 4NZD
  • PDBsum: 3TGX 4NZD
  • STRING: ENSP00000338010
• Other Databases: GeneCards:  IL21R  Malacards:  IL21R

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004896	cytokine receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004896	cytokine receptor activity	IDA	molecular function
GO:0004888	transmembrane signaling receptor activity	IDA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0038114	interleukin-21-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004896	cytokine receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0030101	natural killer cell activation	NAS	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0001532	interleukin-21 receptor activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway
hsa04659	Th17 cell differentiation
hsa05321	Inflammatory bowel disease

Diseases

Associated diseases	References
Inflammatory bowel disease	PMID:19322899
diffuse large B-cell lymphoma	PMID:11821949
common variable immunodeficiency	PMID:18254984
Behcet's disease	PMID:21724243
Temporal arteritis	PMID:22147555
Multiple sclerosis	PMID:21281812
Multiple sclerosis	PMID:20072140
Atopic dermatitis	PMID:19075398
B-cell lymphoma	PMID:11821949
Crohn's disease	PMID:22021194
Systemic lupus erythematosus	PMID:19644854
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881