• Gene id: 50604

Gene Summary

• Gene Symbol: IL20   Gene   UCSC   Ensembl
• Aliases: IL-20, IL10D, ZCYTO10
• Gene name: interleukin 20
• Alternate names: interleukin-20, cytokine Zcyto10, four alpha helix cytokine,
• Gene location: 1q32.1 (128028058: 127941216)     Exons: 22     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a cytokine structurally related to interleukin 10 (IL10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for
• OMIM: 605619

Protein Summary

• Protein general information: Q9NYY1  
  • Name: Interleukin 20 (IL 20) (Cytokine Zcyto10)
  • Length: 176  
  • Mass: 20072
  • Tissue specificity: Expressed in most tissues and five major cell types
• Sequence:

  MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTK
  PANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFE
  KLEPQAAVVKALGELDILLQWMEETE

• Structural information:
  • Interpro: IPR009079  IPR020443  IPR020423  IPR020442  
  • Prosite: PS00520
  • PDB: 4DOH
  • PDBsum: 4DOH
  • STRING: ENSP00000356065
• Other Databases: GeneCards:  IL20  Malacards:  IL20

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0045672	positive regulation of osteoclast differentiation	IEA	biological process
GO:0045518	interleukin-22 receptor binding	IEA	molecular function
GO:0045517	interleukin-20 receptor binding	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0045618	positive regulation of keratinocyte differentiation	TAS	biological process
GO:0045606	positive regulation of epidermal cell differentiation	TAS	biological process
GO:0045517	interleukin-20 receptor binding	TAS	molecular function
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	TAS	biological process
GO:0050727	regulation of inflammatory response	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Rheumatoid arthritis	PMID:16947773
Psoriasis	PMID:21109726
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881