• Gene id: 5055

Gene Summary

• Gene Symbol: SERPINB2   Gene   UCSC   Ensembl
• Aliases: HsT1201, PAI, PAI-2, PAI2, PLANH2
• Gene name: serpin family B member 2
• Alternate names: plasminogen activator inhibitor 2, monocyte Arg-serpin, placental plasminogen activator inhibitor, plasminogen activator inhibitor, type II (arginine-serpin), serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 2, serpin B2, serpin peptidase ,
• Gene location: 18q21.33-q22.1 (63887704: 63903889)     Exons: 10     NC_000018.10
• OMIM: 173390

Protein Summary

• Protein general information: P05120  
  • Name: Plasminogen activator inhibitor 2 (PAI 2) (Monocyte Arg serpin) (Placental plasminogen activator inhibitor) (Serpin B2) (Urokinase inhibitor)
  • Length: 415  
  • Mass: 46596
• Sequence:

  MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAVTPMTPEN
  FTSCGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYS
  SEPQAVDFLECAEEARKKINSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVN
  SAQRTPVQMMYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKM
  AEDEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTEAAAGTGG
  VMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP

• Structural information:
  • Interpro: IPR015556  IPR023795  IPR023796  IPR000215  IPR036186   IPR042178  IPR042185  
  • Prosite: PS00284
  • PDB: 1BY7 1JRR 2ARQ 2ARR
  • PDBsum: 1BY7 1JRR 2ARQ 2ARR
  • STRING: ENSP00000401645
• Other Databases: GeneCards:  SERPINB2  Malacards:  SERPINB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IBA	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0035722	interleukin-12-mediated signaling pathway	TAS	biological process
GO:0042730	fibrinolysis	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0042060	wound healing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04610	Complement and coagulation cascades
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)