• Gene id: 5052

Gene Summary

• Gene Symbol: PRDX1   Gene   UCSC   Ensembl
• Aliases: MSP23, NKEF-A, NKEFA, PAG, PAGA, PAGB, PRX1, PRXI, TDPX2
• Gene name: peroxiredoxin 1
• Alternate names: peroxiredoxin-1, natural killer cell-enhancing factor A, natural killer-enhancing factor A, proliferation-associated gene A, proliferation-associated gene protein, thioredoxin peroxidase 2, thioredoxin-dependent peroxide reductase 2,
• Gene location: 1p34.1 (45522889: 45511034)     Exons: 7     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of C
• OMIM: 176763

SNPs

rs4541736

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000006.12   g.40722258C>A
NC_000006.12   g.40722258C>G
NC_000006.12   g.40722258C>T
NC_000006.11   g.40689997C>A
NC_000006.11   g.40689997C>G
NC_000006.11   g.40689997C>T|SEQ=[C/A/G/T]|GENE=LOC105375052

Protein Summary

• Protein general information: Q06830  
  • Name: Peroxiredoxin 1 (EC 1.11.1.15) (Natural killer cell enhancing factor A) (NKEF A) (Proliferation associated gene protein) (PAG) (Thioredoxin peroxidase 2) (Thioredoxin dependent peroxide reductase 2)
  • Length: 199  
  • Mass: 22,110
• Sequence:

  MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIG
  ASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVG
  RSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

• Structural information:
  • Protein Domains: Thioredoxin. (6-165)
  • Interpro: IPR000866  IPR024706  IPR019479  IPR036249  IPR013766  
  • Prosite: PS51352
  • PDB: 2RII 3HY2 4XCS
  • PDBsum: 2RII 3HY2 4XCS
  • DIP: 33152
  • STRING: ENSP00000262746
• Other Databases: GeneCards:  PRDX1  Malacards:  PRDX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0001501	skeletal system development	TAS	biological process
GO:0001895	retina homeostasis	IEP	biological process
GO:0004601	peroxidase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0008283	cell proliferation	IEA	biological process
GO:0008379	thioredoxin peroxidase activity	EXP	molecular function
GO:0008379	thioredoxin peroxidase activity	EXP	molecular function
GO:0008379	thioredoxin peroxidase activity	EXP	molecular function
GO:0008379	thioredoxin peroxidase activity	IDA	molecular function
GO:0019430	removal of superoxide radicals	IEA	biological process
GO:0032872	regulation of stress-activated MAPK cascade	IEA	biological process
GO:0034101	erythrocyte homeostasis	IEA	biological process
GO:0042267	natural killer cell mediated cytotoxicity	IEA	biological process
GO:0042345	regulation of NF-kappaB import into nucleus	IEA	biological process
GO:0042470	melanosome	IEA	cellular component
GO:0042744	hydrogen peroxide catabolic process	IDA	biological process
GO:0042744	hydrogen peroxide catabolic process	IDA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0043209	myelin sheath	IEA	cellular component
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0000302	response to reactive oxygen species	IEA	biological process
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0001501	skeletal system development	TAS	biological process
GO:0001895	retina homeostasis	IEP	biological process
GO:0004601	peroxidase activity	IEA	molecular function
GO:0004601	peroxidase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006979	response to oxidative stress	IEA	biological process
GO:0008283	cell proliferation	IEA	biological process
GO:0008283	cell proliferation	TAS	biological process
GO:0008379	thioredoxin peroxidase activity	EXP	molecular function
GO:0008379	thioredoxin peroxidase activity	EXP	molecular function
GO:0008379	thioredoxin peroxidase activity	EXP	molecular function
GO:0008379	thioredoxin peroxidase activity	IDA	molecular function
GO:0016209	antioxidant activity	IEA	molecular function
GO:0016209	antioxidant activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0019430	removal of superoxide radicals	IEA	biological process
GO:0032872	regulation of stress-activated MAPK cascade	IEA	biological process
GO:0034101	erythrocyte homeostasis	IEA	biological process
GO:0042267	natural killer cell mediated cytotoxicity	IEA	biological process
GO:0042345	regulation of NF-kappaB import into nucleus	IEA	biological process
GO:0042470	melanosome	IEA	cellular component
GO:0042744	hydrogen peroxide catabolic process	IDA	biological process
GO:0042744	hydrogen peroxide catabolic process	IDA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0043209	myelin sheath	IEA	cellular component
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0051920	peroxiredoxin activity	IEA	molecular function
GO:0051920	peroxiredoxin activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0001501	skeletal system development	TAS	biological process
GO:0001895	retina homeostasis	IEP	biological process
GO:0004601	peroxidase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0008283	cell proliferation	TAS	biological process
GO:0008379	thioredoxin peroxidase activity	EXP	molecular function
GO:0008379	thioredoxin peroxidase activity	EXP	molecular function
GO:0008379	thioredoxin peroxidase activity	EXP	molecular function
GO:0008379	thioredoxin peroxidase activity	IDA	molecular function
GO:0042744	hydrogen peroxide catabolic process	IDA	biological process
GO:0042744	hydrogen peroxide catabolic process	IDA	biological process
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04146	Peroxisome
hsa05146	Amoebiasis

Diseases

Associated diseases	References
Polycystic ovary syndrome (PCOS)	INFBASE: 23382852
Preterm birth risk	INFBASE: 23382852
Asthenozoospermia	MIK: 25202954
Hypospermatogenesis	MIK: 28361989
Idiopathic asthenozoospermia	MIK: 25202954
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25202954	Idiopathic asthenozoospermia			41 (26 idiopathic asthenozoospermia patients, 15 men with fertility history and normal semen)	Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray