• Gene id: 50512

Gene Summary

• Gene Symbol: PODXL2   Gene   UCSC   Ensembl
• Aliases: EG, PODLX2
• Gene name: podocalyxin like 2
• Alternate names: podocalyxin-like protein 2, endoglycan,
• Gene location: 3q21.3 (127629184: 127672801)     Exons: 8     NC_000003.12
• Gene summary(Entrez): This gene is a member of the CD34 family of cell surface transmembrane proteins, which are characterized by an N-terminal extracellular mucin domain, globular and stalk domains, a single pass transmembrane region, and a charged cytoplasmic tail. The encod
• OMIM: 611419

Protein Summary

• Protein general information: Q9NZ53  
  • Name: Podocalyxin like protein 2 (Endoglycan)
  • Length: 605  
  • Mass: 65076
  • Tissue specificity: Expressed in T-cells, B-cells and monocytes. Expression is higher on memory and germinal center cells than on naive B-cells (at protein level). Highly expressed in brain. Moderately expressed in pancreas, kidney and lymphoid node. Weak
• Sequence:

  MGRLLRAARLPPLLSPLLLLLVGGAFLGACVAGSDEPGPEGLTSTSLLDLLLPTGLEPLDSEEPSETMGLGAGLG
  APGSGFPSEENEESRILQPPQYFWEEEEELNDSSLDLGPTADYVFPDLTEKAGSIEDTSQAQELPNLPSPLPKMN
  LVEPPWHMPPREEEEEEEEEEEREKEEVEKQEEEEEEELLPVNGSQEEAKPQVRDFSLTSSSQTPGATKSRHEDS
  GDQASSGVEVESSMGPSLLLPSVTPTTVTPGDQDSTSQEAEATVLPAAGLGVEFEAPQEASEEATAGAAGLSGQH
  EEVPALPSFPQTTAPSGAEHPDEDPLGSRTSASSPLAPGDMELTPSSATLGQEDLNQQLLEGQAAEAQSRIPWDS
  TQVICKDWSNLAGKNYIILNMTENIDCEVFRQHRGPQLLALVEEVLPRHGSGHHGAWHISLSKPSEKEQHLLMTL
  VGEQGVVPTQDVLSMLGDIRRSLEEIGIQNYSTTSSCQARASQVRSDYGTLFVVLVVIGAICIIIIALGLLYNCW
  QRRLPKLKHVSHGEELRFVENGCHDNPTLDVASDSQSEMQEKHPSLNGGGALNGPGSWGALMGGKRDPEDSDVFE
  EDTHL

• Structural information:
  • Interpro: IPR013836  IPR042397  
  • STRING: ENSP00000345359
• Other Databases: GeneCards:  PODXL2  Malacards:  PODXL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050901	leukocyte tethering or rolling	IBA	biological process
GO:0050901	leukocyte tethering or rolling	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005539	glycosaminoglycan binding	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R