• Gene id: 50486

Gene Summary

• Gene Symbol: G0S2   Gene   UCSC   Ensembl
• Gene name: G0/G1 switch 2
• Alternate names: G0/G1 switch protein 2, G0/G1 switch regulatory protein 2, G0/G1switch 2,
• Gene location: 1q32.2 (73233424: 73253021)     Exons: 14     NC_000002.12
• OMIM: 614447

Protein Summary

• Protein general information: P27469  
  • Name: G0/G1 switch protein 2 (G0/G1 switch regulatory protein 2) (Putative lymphocyte G0/G1 switch gene)
  • Length: 103  
  • Mass: 11321
  • Tissue specificity: Widely expressed with highest levels in peripheral blood, skeletal muscle and heart, followed by kidney and liver. {ECO
• Sequence:

  METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQAL
  QKQALQEKGKQQDTVLGGRALSNRQHAS

• Structural information:
  • Interpro: IPR016821  
  • STRING: ENSP00000355996
• Other Databases: GeneCards:  G0S2  Malacards:  G0S2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005811	lipid droplet	TAS	cellular component
GO:0019216	regulation of lipid metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IDA	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)