About Us

Search Result


Gene id 5047
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol PAEP   Gene   UCSC   Ensembl
Aliases GD, GdA, GdF, GdS, PAEG, PEP, PP14, ZIF-1
Gene name progestagen associated endometrial protein
Alternate names glycodelin, PEG, PP14 protein (placental protein 14), alpha uterine protein, glycodelin-A, glycodelin-F, glycodelin-S, placental protein 14, pregnancy-associated endometrial alpha-2 globulin, progestagen-associated endometrial protein (placental protein 1,
Gene location 9q34.3 (135561626: 135566775)     Exons: 7     NC_000009.12
Gene summary(Entrez) This gene is a member of the kernel lipocalin superfamily whose members share relatively low sequence similarity but have highly conserved exon/intron structure and three-dimensional protein folding. Most lipocalins are clustered on the long arm of chromo
OMIM 173310

Protein Summary

Protein general information P09466  

Name: Glycodelin (GD) (Placental protein 14) (PP14) (Pregnancy associated endometrial alpha 2 globulin) (PAEG) (PEG) (Progestagen associated endometrial protein) (Progesterone associated endometrial protein) (Zona binding inhibitory factor 1) (ZIF 1)

Length: 180  Mass: 20,624

Sequence MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIV
LHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEI
MQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
Structural information
Interpro:  IPR002447  IPR012674  IPR002345  IPR022272  IPR000566  
Prosite:   PS00213

PDB:  
4R0B
PDBsum:   4R0B
MINT:  
STRING:   ENSP00000277508
Other Databases GeneCards:  PAEP  Malacards:  PAEP

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005515 protein binding
IPI molecular function
GO:0005576 extracellular region
IEA cellular component
GO:0006810 transport
IEA biological process
GO:0006915 apoptotic process
IDA biological process
GO:0007275 multicellular organism de
velopment
TAS biological process
GO:0032725 positive regulation of gr
anulocyte macrophage colo
ny-stimulating factor pro
duction
IDA biological process
GO:0036094 small molecule binding
IEA molecular function
GO:2000667 positive regulation of in
terleukin-13 secretion
IDA biological process
GO:2000778 positive regulation of in
terleukin-6 secretion
IDA biological process
GO:0005515 protein binding
IPI molecular function
GO:0005576 extracellular region
IEA cellular component
GO:0005576 extracellular region
IEA cellular component
GO:0006810 transport
IEA biological process
GO:0006915 apoptotic process
IDA biological process
GO:0007275 multicellular organism de
velopment
TAS biological process
GO:0032725 positive regulation of gr
anulocyte macrophage colo
ny-stimulating factor pro
duction
IDA biological process
GO:0036094 small molecule binding
IEA molecular function
GO:2000667 positive regulation of in
terleukin-13 secretion
IDA biological process
GO:2000778 positive regulation of in
terleukin-6 secretion
IDA biological process
GO:0005515 protein binding
IPI molecular function
GO:0006915 apoptotic process
IDA biological process
GO:0007275 multicellular organism de
velopment
TAS biological process
GO:0032725 positive regulation of gr
anulocyte macrophage colo
ny-stimulating factor pro
duction
IDA biological process
GO:2000667 positive regulation of in
terleukin-13 secretion
IDA biological process
GO:2000778 positive regulation of in
terleukin-6 secretion
IDA biological process
Associated diseases References
Recurrent implantation failure (RIF) INFBASE: 25747132
Endometrial receptivity INFBASE: 16939926
Endometriosis INFBASE: 22563871
Female infertility INFBASE: 21292383
Implantation failure INFBASE: 18077318
Ovarian endometriosis INFBASE: 23461865
Polycystic ovary syndrome (PCOS) INFBASE: 14764802
Retarded endometrial differentiation INFBASE: 8006124
Sperm morphology MIK: 17482165
Sperm motility MIK: 7531163
Male factor infertility MIK: 9755428
Azoospermia MIK: 22182811
Azoospermia MIK: 22182811
Cryptorchidism MIK: 28606200
Male infertility MIK: 9755428
Sperm motility MIK: 7531163
Spermatogenic defects MIK: 17482165
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
9755428 Male infer
tility


Male infertility
Show abstract
7531163 Sperm moti
lity


Male infertility
Show abstract
17482165 Sperm morp
hology

42 patients
Male infertility
Show abstract
22182811 Azoospermi
a


Male infertility Lactoferrin
Prostatic acid phosphatase
Human Zinc-Alpha-2-Glycoprotein
Prostate specific antigen
Progestagen-associated endometrial protein
Kinesin light chain 4
Kinesin light chain 4
Prolactin inducible protein
Izumo sperm-egg fusion protein 1
Show abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract