• Gene id: 5045

Gene Summary

• Gene Symbol: FURIN   Gene   UCSC   Ensembl
• Aliases: FUR, PACE, PCSK3, SPC1
• Gene name: furin, paired basic amino acid cleaving enzyme
• Alternate names: furin, FES upstream region, dibasic processing enzyme, furin, membrane associated receptor protein, paired basic amino acid residue-cleaving enzyme, proprotein convertase subtilisin/kexin type 3,
• Gene location: 15q26.1 (90868587: 90883457)     Exons: 18     NC_000015.10
• Gene summary(Entrez): This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. It encodes a type 1 membr
• OMIM: 605286

Protein Summary

• Protein general information: P09958  
  • Name: Furin (EC 3.4.21.75) (Dibasic processing enzyme) (Paired basic amino acid residue cleaving enzyme) (PACE)
  • Length: 794  
  • Mass: 86678
  • Tissue specificity: Seems to be expressed ubiquitously. {ECO
• Sequence:

  MELRPWLLWVVAATGTLVLLAADAQGQKVFTNTWAVRIPGGPAVANSVARKHGFLNLGQIFGDYYHFWHRGVTKR
  SLSPHRPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVS
  ILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVR
  MLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREH
  DSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAA
  GIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKC
  IIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSA
  DGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCE
  EGFSLHQKSCVQHCPPGFAPQVLDTHYSTENDVETIRASVCAPCHASCATCQGPALTDCLSCPSHASLDPVEQTC
  SRQSQSSRESPPQQQPPRLPPEVEAGQRLRAGLLPSHLPEVVAGLSCAFIVLVFVTVFLVLQLRSGFSFRGVKVY
  TMDRGLISYKGLPPEAWQEECPSDSEEDEGRGERTAFIKDQSAL

• Structural information:
  • Protein Domains: (121..43-)
    (/note="Peptidase-S8)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01240-)
    (444..57-)
    (/note="P/Homo-B)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01173"-)
  • Interpro: IPR006212  IPR008979  IPR009030  IPR034182  IPR002884   IPR000209  IPR036852  IPR023827  IPR022398  IPR023828  IPR015500  IPR032815  IPR038466  
  • Prosite: PS51829 PS51892 PS00136 PS00137 PS00138
  • CDD: cd00064 cd04059
  • PDB: 4OMC 4OMD 4RYD 4Z2A 5JMO 5JXG 5JXH 5JXI 5JXJ 5MIM 6A8Y 6EQV 6EQW 6EQX 6HLB 6HLD 6HLE 6HZA 6HZB 6HZC 6HZD
  • PDBsum: 4OMC 4OMD 4RYD 4Z2A 5JMO 5JXG 5JXH 5JXI 5JXJ 5MIM 6A8Y 6EQV 6EQW 6EQX 6HLB 6HLD 6HLE 6HZA 6HZB 6HZC 6HZD
  • DIP: 29904
  • STRING: ENSP00000483552
• Other Databases: GeneCards:  FURIN  Malacards:  FURIN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006465	signal peptide processing	IDA	biological process
GO:0032804	negative regulation of low-density lipoprotein particle receptor catabolic process	IDA	biological process
GO:0004252	serine-type endopeptidase activity	IBA	molecular function
GO:0005802	trans-Golgi network	IBA	cellular component
GO:0016485	protein processing	IBA	biological process
GO:0030173	integral component of Golgi membrane	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0016486	peptide hormone processing	IBA	biological process
GO:0016485	protein processing	IDA	biological process
GO:0008233	peptidase activity	IDA	molecular function
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:1901394	positive regulation of transforming growth factor beta1 activation	IDA	biological process
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030140	trans-Golgi network transport vesicle	IDA	cellular component
GO:0016485	protein processing	IDA	biological process
GO:0008233	peptidase activity	IDA	molecular function
GO:0008233	peptidase activity	IDA	molecular function
GO:0004175	endopeptidase activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007179	transforming growth factor beta receptor signaling pathway	TAS	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030574	collagen catabolic process	TAS	biological process
GO:0032455	nerve growth factor processing	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0051004	regulation of lipoprotein lipase activity	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0006465	signal peptide processing	TAS	biological process
GO:0019082	viral protein processing	TAS	biological process
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0070268	cornification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016485	protein processing	IEA	biological process
GO:0001825	blastocyst formation	IEA	biological process
GO:0045714	regulation of low-density lipoprotein particle receptor biosynthetic process	IEA	biological process
GO:0009966	regulation of signal transduction	IEA	biological process
GO:0005783	endoplasmic reticulum	IGI	cellular component
GO:0008233	peptidase activity	IDA	molecular function
GO:0016485	protein processing	IDA	biological process
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0048406	nerve growth factor binding	IDA	molecular function
GO:0004175	endopeptidase activity	IDA	molecular function
GO:0004175	endopeptidase activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0042277	peptide binding	IDA	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0005615	extracellular space	IDA	NOT|cellular component
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0016485	protein processing	IDA	biological process
GO:0016485	protein processing	IDA	biological process
GO:0016485	protein processing	IDA	biological process
GO:0032902	nerve growth factor production	IDA	biological process
GO:0032904	negative regulation of nerve growth factor production	IDA	NOT|biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0016485	protein processing	IMP	biological process
GO:0032911	negative regulation of transforming growth factor beta1 production	IMP	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0016486	peptide hormone processing	IDA	biological process
GO:0032940	secretion by cell	IDA	biological process
GO:0043043	peptide biosynthetic process	IDA	biological process
GO:0051044	positive regulation of membrane protein ectodomain proteolysis	IC	biological process
GO:0052548	regulation of endopeptidase activity	IDA	biological process
GO:0019058	viral life cycle	IEP	biological process
GO:0042176	regulation of protein catabolic process	IMP	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0000139	Golgi membrane	IMP	cellular component
GO:0004252	serine-type endopeptidase activity	IMP	molecular function
GO:0000139	Golgi membrane	IMP	cellular component
GO:0090472	dibasic protein processing	IMP	biological process
GO:0031638	zymogen activation	IMP	biological process
GO:0004175	endopeptidase activity	IMP	molecular function
GO:0004252	serine-type endopeptidase activity	IMP	molecular function
GO:0031638	zymogen activation	IMP	biological process

Diseases

Associated diseases	References
Arteriosclerosis	PMID:15756593
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq