• Gene id: 5037

Gene Summary

• Gene Symbol: PEBP1   Gene   UCSC   Ensembl
• Aliases: HCNP, HCNPpp, HEL-210, HEL-S-34, HEL-S-96, PBP, PEBP, PEBP-1, RKIP
• Gene name: phosphatidylethanolamine binding protein 1
• Alternate names: phosphatidylethanolamine-binding protein 1, Raf kinase inhibitory protein, epididymis luminal protein 210, epididymis secretory protein Li 34, epididymis secretory protein Li 96, hippocampal cholinergic neurostimulating peptide, neuropolypeptide h3, prostatic bi,
• Gene location: 12q24.23 (11575254: 11619160)     Exons: 6     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the phosphatidylethanolamine-binding family of proteins and has been shown to modulate multiple signaling pathways, including the MAP kinase (MAPK), NF-kappa B, and glycogen synthase kinase-3 (GSK-3) signaling pathways. The e
• OMIM: 604591

Protein Summary

• Protein general information: P30086  
  • Name: Phosphatidylethanolamine binding protein 1 (PEBP 1) (HCNPpp) (Neuropolypeptide h3) (Prostatic binding protein) (Raf kinase inhibitor protein) (RKIP) [Cleaved into: Hippocampal cholinergic neurostimulating peptide (HCNP)]
  • Length: 187  
  • Mass: 21057
• Sequence:

  MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPS
  RKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFK
  VASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

• Structural information:
  • Interpro: IPR008914  IPR036610  IPR035810  IPR001858  
  • Prosite: PS01220
  • CDD: cd00866
  • PDB: 1BD9 1BEH 2L7W 2QYQ
  • PDBsum: 1BD9 1BEH 2L7W 2QYQ
  • DIP: 44269
  • STRING: ENSP00000261313
• Other Databases: GeneCards:  PEBP1  Malacards:  PEBP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043409	negative regulation of MAPK cascade	IBA	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008429	phosphatidylethanolamine binding	TAS	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Prostate cancer	PMID:18722266
Alzheimer's disease	PMID:10210891
Ovarian cancer	PMID:18652693
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq