• Gene id: 503542

Gene Summary

• Gene Symbol: SPRN   Gene   UCSC   Ensembl
• Aliases: SHADOO, SHO, bA108K14.1
• Gene name: shadow of prion protein
• Alternate names: shadow of prion protein, hypothetical protein BC004409, protein shadoo, shadow of prion protein homolog,
• Gene location: 10q26.3 (133424616: 133420665)     Exons: 2     NC_000010.11
• OMIM: 610570

Protein Summary

• Protein general information: Q5BIV9  
  • Name: Shadow of prion protein (Protein shadoo)
  • Length: 151  
  • Mass: 14522
  • Tissue specificity: Mainly expressed in brain. In brain, it is expressed in hippocampus. {ECO
• Sequence:

  MNWAPATCWALLLAAAFLCDSGAAKGGRGGARGSARGGVRGGARGASRVRVRPAQRYGAPGSSLRVAAAGAAAGA
  AAGAAAGLAAGSGWRRAAGPGERGLEDEEDGVPGGNGTGPGIYSYRAWTSGAGPTRGPRLCLVLGGALGALGLLR
  P

• Structural information:
  • Interpro: IPR029238  
  • STRING: ENSP00000433712
• Other Databases: GeneCards:  SPRN  Malacards:  SPRN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006606	protein import into nucleus	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003676	nucleic acid binding	IBA	molecular function
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006606	protein import into nucleus	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0031982	vesicle	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq