• Gene id: 5032

Gene Summary

• Gene Symbol: P2RY11   Gene   UCSC   Ensembl
• Aliases: P2Y11
• Gene name: purinergic receptor P2Y11
• Alternate names: P2Y purinoceptor 11, purinergic receptor P2Y, G-protein coupled, 11,
• Gene location: 19p13.2 (10111692: 10115371)     Exons: 2     NC_000019.10
• Gene summary(Entrez): The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor
• OMIM: 602697

Protein Summary

• Protein general information: Q96G91  
  • Name: P2Y purinoceptor 11 (P2Y11)
  • Length: 374  
  • Mass: 40345
  • Tissue specificity: Highest expression in liver and spleen. {ECO
• Sequence:

  MAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRPWHPAVVFSVQLAVSD
  LLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFITCISLNRYLGIVHPFFARSHLRPKHAWAVS
  AAGWVLAALLAMPTLSFSHLKRPQQGAGNCSVARPEACIKCLGTADHGLAAYRAYSLVLAGLGCGLPLLLTLAAY
  GALGRAVLRSPGMTVAEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWSTRCPSFADIAQATAALELGPY
  VGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR027677  
  • Prosite: PS00237 PS50262
  • PDB: 2B6S
  • PDBsum: 2B6S
• Other Databases: GeneCards:  P2RY11  Malacards:  P2RY11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030594	neurotransmitter receptor activity	IBA	molecular function
GO:0045031	G protein-coupled ATP receptor activity	IBA	molecular function
GO:0023041	neuronal signal transduction	IBA	biological process
GO:0023041	neuronal signal transduction	IEA	biological process
GO:0045031	G protein-coupled ATP receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030594	neurotransmitter receptor activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007190	activation of adenylate cyclase activity	TAS	biological process
GO:0006952	defense response	TAS	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0045031	G protein-coupled ATP receptor activity	IDA	molecular function
GO:0030594	neurotransmitter receptor activity	IDA	molecular function
GO:0023041	neuronal signal transduction	IDA	biological process
GO:0071318	cellular response to ATP	IDA	biological process
GO:0005887	integral component of plasma membrane	IC	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0019722	calcium-mediated signaling	IDA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0035589	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA	biological process
GO:0035589	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA	biological process
GO:0035589	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq